KEGG   Bubalus bubalis (water buffalo): 102401542Help
Entry
102401542         CDS       T05912                                 

Gene name
CHAT
Definition
(RefSeq) choline O-acetyltransferase
  KO
K00623  choline O-acetyltransferase [EC:2.3.1.6]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00564  Glycerophospholipid metabolism
bbub04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102401542 (CHAT)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    102401542 (CHAT)
Enzymes [BR:bbub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.6  choline O-acetyltransferase
     102401542 (CHAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 102401542
NCBI-ProteinID: XP_025140705
LinkDB All DBs
Position
4
AA seq 668 aa AA seqDB search
MRRQQRGGEQEESRSTPLRPQSEATKMPICEKAPPKMAAKSPGSEEEPGLPKLPVPPLQQ
TLATYLRCMQHLVPQEQFRRSQAIVQQFGAPGGLGETLQQKLLERQEKTANWVSEYWLND
MYLNNRLALPVNSSPAVIFARQHFQDTNDQLRFAANLISGVLSYKALLDSHSIPTDCAKG
QLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQKSSVMPEPEHVIVACCNQFFVLDVVINF
RRLSEGDLFTQLRKIVRMASNEDERLPPIGLLTSDGRSEWNEARTVLMKDSTNRDSLDMI
ERCICLVCLDAPGGMELSDTNRALQLLHGGGCSKNGANRWYDKSLQFVVGRDGSCGVVCE
HSPFDGIVLVQCTEHLLRHMVKTSKKMVRADSVSELPAPRRLRWKCSPEIQGLLASSAEK
LQQIVKNLDFTVYKFDDYGKTFIKQQKCSPDAFIQVALQLAFYRLHGKLVPTYESASIRR
FHEGRVDNIRSATPEALRFVKAIADHHTAAVPDSEKLLLLKDAIQAQTEYTVMAITGMAI
DNHLLGLRELAREMCKELPEMFTDETYLTSNRFVLSTSQVPTTMEMFCCYGPVVPNGYGA
CYNPQPESILFCISSFHNCKETSSTRFAKAVEESLLEMRRLCSLPLSATGKPPATKETVT
RPSQGHQP
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggcagcagagaggaggagagcaggaggagagcaggtccacacctctgcgtcca
caatcagaagccaccaagatgcccatctgtgaaaaagctccccctaagatggcggcaaaa
agtccaggcagtgaggaggagcctgggctgcccaaactccctgtgcccccgctgcagcag
accctggccacctatctgcggtgcatgcagcacctggtgccccaggagcaattcaggagg
agccaggccatcgtgcagcagtttggggcccctggtggccttggcgagaccctgcagcag
aagctcctagaacggcaggagaagactgccaactgggtgtccgagtactggctgaacgac
atgtatctcaacaatcgcctggccctgcctgtcaactccagcccagctgtgatctttgcc
cggcagcacttccaagacaccaatgaccagttaaggtttgcagccaacctcatctccggc
gtgctcagctacaaggccctgctggacagccactccatccccaccgactgtgccaagggc
cagctatcagggcagccgctctgtatgaagcaatactacgggctcttctcctcctaccgg
ctccctggccacacccaggacacgctggtggcccagaagagcagtgtcatgcccgagccg
gagcacgtcattgtggcctgctgcaaccagttctttgtcttggatgttgtgattaatttc
cgccgtctcagtgagggggatctgttcactcagttgagaaagatagtcagaatggcttcc
aacgaggatgaacgcttgcctccaatcggcctgctgacgtcagacgggaggagcgagtgg
aatgaggccaggacggtcctcatgaaagactccaccaaccgggactctctggatatgatt
gagcggtgcatctgcctggtgtgcctggatgcccccggaggcatggagctcagtgacacc
aaccgggcgctccagctcctccacggtggaggctgcagcaagaacggggccaaccgctgg
tacgacaagtccctgcagttcgtggttggccgagatggcagctgtggagtggtatgtgaa
cactctcctttcgacggcatcgtcttggtgcagtgcacggagcatctgctcaggcacatg
gtgaagactagcaagaagatggtccgagctgactcggtcagcgagctcccagcacccaga
aggctgaggtggaagtgctccccggaaattcaaggcctcttagcctcctcagcagaaaaa
cttcaacaaatagtaaagaatctcgacttcaccgtttataagtttgatgactatgggaaa
acattcattaagcagcagaaatgcagccccgatgcctttattcaggtggccctccagctg
gccttctacaggctccacgggaaactcgtgcccacctacgagagcgcctccatccggcgg
ttccacgagggacgggtggacaacattcgatcggccacgccggaggcactgcgttttgtg
aaagccatcgctgaccaccacacagccgccgtgccggattcggagaagctgcttctcctg
aaggatgccatccaagcccagacggagtacacggtcatggccataacagggatggccatc
gacaaccacctgctggggctgcgggagctggcccgggaaatgtgcaaggaactgcccgag
atgttcacggatgaaacatatctgacaagcaaccggtttgtgctctccaccagccaggta
cccaccaccatggagatgttttgctgctatggtcccgtggtacccaatgggtacggtgcc
tgctacaacccccagccagagagcatccttttctgcatctccagcttccacaattgcaag
gagacatcatcaaccaggtttgcaaaagctgtggaagaaagccttcttgaaatgagacgc
ctctgcagtctgccactgtcggccacaggcaagccaccggcaacaaaggaaacagtaaca
aggcccagtcaggggcaccaaccttga

DBGET integrated database retrieval system