KEGG   Bubalus bubalis (water buffalo): 102401701Help
Entry
102401701         CDS       T05912                                 

Gene name
MMP2
Definition
(RefSeq) 72 kDa type IV collagenase
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01522  Endocrine resistance
bbub04670  Leukocyte transendothelial migration
bbub04912  GnRH signaling pathway
bbub04915  Estrogen signaling pathway
bbub04926  Relaxin signaling pathway
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub05200  Pathways in cancer
bbub05205  Proteoglycans in cancer
bbub05219  Bladder cancer
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102401701 (MMP2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102401701 (MMP2)
   04915 Estrogen signaling pathway
    102401701 (MMP2)
   04926 Relaxin signaling pathway
    102401701 (MMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102401701 (MMP2)
   05205 Proteoglycans in cancer
    102401701 (MMP2)
  09162 Cancer: specific types
   05219 Bladder cancer
    102401701 (MMP2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102401701 (MMP2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102401701 (MMP2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102401701 (MMP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bbub01002]
    102401701 (MMP2)
Enzymes [BR:bbub01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     102401701 (MMP2)
Peptidases and inhibitors [BR:bbub01002]
 Metallo peptidases
  Family M10
   102401701 (MMP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Peptidase_M66 Reprolysin_4
Motif
Other DBs
NCBI-GeneID: 102401701
NCBI-ProteinID: XP_006053742
LinkDB All DBs
Position
18
AA seq 661 aa AA seqDB search
MTEARVSRGALFAPLRALCVLGCLLGRAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYG
CPKESCNLFVLKDTLKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDVANYNFFPRKPKW
DKNQITYRIIGYTPDLDPQTVDDAFARAFQVWSDVTPLQFSRIHDGEADIMINFGRWEHG
DGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFRF
NGKEYTSCTDIGRSDGFLWCSTTYNFDKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQG
TSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVLPFTFLGNK
HESCTSAGRSDGKLWCATTSNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGA
LMAPIYTYTKNFRLSHDDIQGIQELYGASPDIDTGTGPTPTLGPVTPELCKQDIVFDGIS
QIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEDPQEEKAVFFAGNE
YWVYSASTLERGYPKPLTSLGLPPDVQKVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMD
PGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLG
C
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggcgcgagtgtcccggggcgcgctgttcgcccctctgcgggcgctctgcgtc
ctgggctgcctgttgggccgtgccgccgccgcgccgtcgcccatcatcaaatttcccggc
gatgtcgcccccaaaacggacaaagagttggctgtgcaatacctaaacaccttctacggt
tgccccaaggagagctgtaacttgtttgtgctgaaggacaccctgaagaagatgcagaag
ttcttcgggttaccccagacaggtgaactggaccagagcaccatcgagaccatgcggaag
ccgcgctgtggcaaccccgacgtggccaactacaacttctttccccgaaagcccaagtgg
gacaagaaccagatcacatacaggatcattggctacacacctgatttggacccccagaca
gtggatgatgccttcgctcgtgccttccaagtctggagcgatgtgaccccgctacagttt
tctcggatccatgatggagaggctgacatcatgatcaactttggccgctgggagcatgga
gatgggtacccttttgatggcaaagatgggctcctggctcatgccttcgccccgggccct
ggagttgggggagattcccacttcgacgacgatgagctgtggactctaggagaaggacaa
gtggtccgtgtgaagtacgggaatgctgacggggaatattgcaagttccccttccggttc
aacggcaaggagtacaccagctgcacagacataggccgcagcgatggcttcctctggtgc
tccaccacgtacaactttgacaaggacggcaagtatggcttctgcccccatgaagccctg
ttcaccatgggcggcaacgctgacggacagccctgcaagttcccgttccgcttccagggc
acgtcttacgacagctgcaccacggagggccgcacggacggctaccgctggtgtggcacc
accgaggactatgaccgtgacaagaagtacggcttctgcccggagactgccatgtccact
gtgggcgggaactcagaaggtgccccatgtgtcctccccttcaccttcctgggcaacaag
cacgagagctgcaccagcgctggccgcagtgatgggaagctgtggtgtgcgaccacctcc
aactacgatgatgaccgcaagtggggcttctgccccgaccaagggtacagcctgttcctg
gtggcagcccatgagtttggccatgcaatggggctggagcactcacaggaccctggagcc
ctgatggcacccatttatacctatactaagaacttccgcctgtcccatgatgacatccag
ggcatccaagaactctatggagcctcccctgacattgatactggcaccggccccacccca
accctgggccctgtcactcctgagctctgcaaacaggacatcgtcttcgatggcatctct
cagatccgtggggagatcttcttcttcaaggaccgattcatctggcgaacagtgacacca
cgtgacaagcccacagggcccctgctggtagccacattctggcctgagctaccggaaaag
atcgatgctgtgtacgaagacccacaggaggagaaggctgtgttctttgcagggaacgaa
tactgggtctattcagccagtaccctggagcgagggtaccccaagccgctgaccagcctg
gggctcccccctgatgtccagaaggtggatgctgcctttaactggagcaagaacaagaag
acatacatcttcgccggagacaaattctggagatacaatgaggtgaagaagaaaatggat
cctggcttccccaagctcatcgccgatgcctggaatgccatccctgataacctggatgct
gtggtggacctgcagggcgggggtcacagctacttcttcaagggcgcctattacctgaag
ttggagaaccaaagtctgaaaagcgtgaagtttggaagcatcaaatccgattggctgggc
tgctga

DBGET integrated database retrieval system