KEGG   Bubalus bubalis (water buffalo): 102401712Help
Entry
102401712         CDS       T05912                                 

Gene name
G6PC
Definition
(RefSeq) glucose-6-phosphatase isoform X1
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00010  Glycolysis / Gluconeogenesis
bbub00052  Galactose metabolism
bbub00500  Starch and sucrose metabolism
bbub01100  Metabolic pathways
bbub04068  FoxO signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04910  Insulin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04922  Glucagon signaling pathway
bbub04931  Insulin resistance
bbub04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102401712 (G6PC)
   00052 Galactose metabolism
    102401712 (G6PC)
   00500 Starch and sucrose metabolism
    102401712 (G6PC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102401712 (G6PC)
   04151 PI3K-Akt signaling pathway
    102401712 (G6PC)
   04152 AMPK signaling pathway
    102401712 (G6PC)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102401712 (G6PC)
   04922 Glucagon signaling pathway
    102401712 (G6PC)
   04920 Adipocytokine signaling pathway
    102401712 (G6PC)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102401712 (G6PC)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102401712 (G6PC)
Enzymes [BR:bbub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     102401712 (G6PC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 102401712
NCBI-ProteinID: XP_006055769
LinkDB All DBs
Position
3
AA seq 357 aa AA seqDB search
MEKGMNVLHDFGIQSTHYLQVNYQNSQDWFILVSVIADLRNAFYVLFPIWFHLREAVGIK
LLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSAPLIKQFPVTCETGPGSPSGHA
MGTAGVYYVMVTSTLSIFRGKKKPTYRFRCLNVMLWLGFWVVQLNVCLSRIYLAAHFPHQ
VVAGVLSGIVVAETFRHIQSIYNASLKKYFLITCFLFSFAIGFYLLLKWLGVDLLWTLEK
AKRRCERPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWFPFRLSCIV
ASLVLLHLFDSLKPPSQIELIFYVLSFCKSAAVPLASVSLIPYCLAWVLGQPNKKTL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggagaagggaatgaacgttctacatgactttgggatccagtcaacacactacctccag
gtgaattaccagaactcccaggattggttcatcttggtgtctgtgattgcagatctcagg
aatgccttttatgtcctcttccccatttggttccatcttcgagaagctgtgggcatcaaa
ctcctctgggtagctgtgattggagattggctcaacctcgtctttaagtggattctcttt
ggacagcgcccatactggtgggttttggacacagactactatagcaacacctcggcaccg
ctgataaagcagttcccggtcacctgtgagaccggcccagggagtccctctggccacgcc
atgggtacagcaggtgtatactatgtgatggtcacatccaccctctctatctttcgcgga
aagaaaaagccaacctacagatttcggtgcttgaatgtcatgttgtggttgggattctgg
gtcgtgcaactgaatgtctgcctgtcacgaatctaccttgctgctcattttccccatcaa
gttgttgctggagtattgtcaggcattgtggttgctgagactttccgccacatccagagc
atctacaatgccagtctcaagaagtactttctcatcacctgcttcctgttcagtttcgcc
attggattttacctgctgttaaagtggctgggggttgacctgctgtggactctcgagaaa
gccaagcgaaggtgtgagcggccggagtgggtccacattgacacgacgccctttgccagc
ctcctcaagaatctggggaccctctttggcttgggtctggctctcaactccagcatgtac
cgggagagctgcaagggcaagctcagcaagtggttcccgtttcgcctcagctgcatcgtg
gcctccctcgtcctcctgcacctctttgactctttgaaacccccctcccaaatcgagctg
atcttctatgtcctgtccttctgcaagagtgcagcggtgcccctggcatctgtcagcctc
atcccctactgcctcgcctgggtgctgggccagcccaacaagaagactttgtaa

KEGG   Bubalus bubalis (water buffalo): 102408431Help
Entry
102408431         CDS       T05912                                 

Gene name
G6PC3
Definition
(RefSeq) glucose-6-phosphatase 3 isoform X1
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00010  Glycolysis / Gluconeogenesis
bbub00052  Galactose metabolism
bbub00500  Starch and sucrose metabolism
bbub01100  Metabolic pathways
bbub04068  FoxO signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04910  Insulin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04922  Glucagon signaling pathway
bbub04931  Insulin resistance
bbub04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102408431 (G6PC3)
   00052 Galactose metabolism
    102408431 (G6PC3)
   00500 Starch and sucrose metabolism
    102408431 (G6PC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102408431 (G6PC3)
   04151 PI3K-Akt signaling pathway
    102408431 (G6PC3)
   04152 AMPK signaling pathway
    102408431 (G6PC3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102408431 (G6PC3)
   04922 Glucagon signaling pathway
    102408431 (G6PC3)
   04920 Adipocytokine signaling pathway
    102408431 (G6PC3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102408431 (G6PC3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102408431 (G6PC3)
Enzymes [BR:bbub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     102408431 (G6PC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 102408431
NCBI-ProteinID: XP_006060634
LinkDB All DBs
Position
3
AA seq 346 aa AA seqDB search
MESTLGAGIAMAEALQNQLPWLENVWLWVTFLGDPKSLFLFYFPAAYYASRRVGIAVLWI
SLITEWLNLVFKWFLFGDRPFWWVHESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGA
ALWPIMTAISSQMATRAHSRWVRVIPSLAYCTFLLAVGLSRVFLLAHFPHQVLAGLITGA
VLGWLMTPQVPMERELSFYGLTSLALLLGASLIYWTLFTLGLDLSWSINLASKWCERPEW
VHLDSRPFASLSRDSGAALGLGIALHSPCYAQVRRAHLGYGQKLVCLVLAMGLLGPLNWL
GYPPQISLFYIFNFLKYTLWPCLVLALVPWLVHMFSAQEAPPIRSS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggagtccacgctgggcgcgggcatcgcgatggccgaggccctgcagaaccagctgccc
tggttggagaacgtgtggctctgggtcacctttctgggggaccccaagagcctctttctg
ttctacttccccgcggcctactatgcgtctcgccgggtaggcattgcggtgctctggatc
agcctcatcaccgagtggctcaacctcgtcttcaagtggtttctgtttggagacaggccc
ttttggtgggtccatgagtctgggtactacagccaggctccagcccaagttcaccaattc
ccctcttcttgtgaaactggcccaggcagcccttctggacactgtatgatcacaggagca
gccctctggcccataatgacggccatctcttcccagatggccactcgggcccacagccgc
tgggtgagggtgattcctagcttggcttattgcaccttcctgctggcggtcggcttatct
cgggtcttcctcttagcacatttccctcaccaggtgttggctggcttaataactggtgct
gtcctgggctggctgatgacccctcaggtgcccatggagcgggagctaagtttctatgga
ttgacctcgctggccctcttgctgggtgccagcctcatctactggaccctctttacactg
ggcctggatctttcttggtccatcaacctagcctctaagtggtgtgagcggcccgagtgg
gtgcacttggacagccggccttttgcctccctgagccgtgactcaggagccgccctgggt
ctgggcatcgctctgcactctccctgctatgcccaggtacggcgggcacacctgggatat
ggccagaaactagtctgtcttgtgctggccatggggctgctgggccccctgaactggctg
ggctacccccctcagatcagccttttctacatcttcaatttcctcaagtataccctctgg
ccatgcctggtcctggcccttgtaccctggctggtgcacatgttcagtgcccaggaagca
ccgcccatccgctcttcctga

KEGG   Bubalus bubalis (water buffalo): 102414800Help
Entry
102414800         CDS       T05912                                 

Gene name
G6PC2
Definition
(RefSeq) glucose-6-phosphatase 2
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00010  Glycolysis / Gluconeogenesis
bbub00052  Galactose metabolism
bbub00500  Starch and sucrose metabolism
bbub01100  Metabolic pathways
bbub04068  FoxO signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04910  Insulin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04922  Glucagon signaling pathway
bbub04931  Insulin resistance
bbub04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102414800 (G6PC2)
   00052 Galactose metabolism
    102414800 (G6PC2)
   00500 Starch and sucrose metabolism
    102414800 (G6PC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102414800 (G6PC2)
   04151 PI3K-Akt signaling pathway
    102414800 (G6PC2)
   04152 AMPK signaling pathway
    102414800 (G6PC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102414800 (G6PC2)
   04922 Glucagon signaling pathway
    102414800 (G6PC2)
   04920 Adipocytokine signaling pathway
    102414800 (G6PC2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102414800 (G6PC2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102414800 (G6PC2)
Enzymes [BR:bbub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     102414800 (G6PC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 102414800
NCBI-ProteinID: XP_006060031
LinkDB All DBs
Position
2
AA seq 355 aa AA seqDB search
MDFLHRNGVLVIQHLQKDYRAYYNFLNFMSNVGDPRNIFSIYFPLWFQLNQTVGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTEALSHAISQMDKSFITLHRLTWSFLWSLFWLIQISVCISRVFIATHFPHQVI
LGVIGGVLVAEVFEYTPGIQTASLSIYLKTNLFLFLFALGFYLLLRRLDIDLLWSVPIAK
KWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLRSYRGENGYRLSFRLLCALVS
LTTLQLYHFIKIPTDTEYLFYVLSFCKSASIPLTVVALIPYCIHMLMKPSAKKLN
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatttccttcataggaatggagtgcttgttattcagcatttgcagaaggactaccga
gcttactacaattttctaaattttatgtccaatgttggagatccccggaatatcttttct
atttattttccactttggtttcaacttaatcagacagttggaactaagatgatatgggta
gcagtcattggggattggttcaatcttatttttaaatggatattatttggtcatcggcct
tactggtgggtccaagaaactcagatttacccaaatcactcaagtccatgccttgaacag
ttccccactacatgcgaaacaggtccaggaagtccatctggccacgcgatgggttcatca
tgcgtctggtatgtcatggtgacagaggccctgagccacgccatcagtcagatggataag
tcttttatcactctgcacagactgacttggtcatttctttggagtctcttttggttgatt
caaatcagtgtctgcatctccagagtattcatagcaacacattttcctcatcaagttatt
cttggagtaattggtggcgtcctggtagcggaggtctttgaatacactccaggtatccaa
acagccagcctgagcatatacctgaagaccaacctgttcctcttcctgtttgcacttggc
ttttacctgcttctcagacgtcttgacattgacctgctgtggtccgtgcccatagccaag
aagtggtgcgccaaccccgactggatccacattgacaccacaccttttgccggacttgtg
agaaacctcggggtcctctttggcttgggctttgcaattaactcagagatgttcctcagg
agctatcgaggagaaaacggctacaggctgagcttccggctgctctgtgccctggtctcg
ctgaccaccctgcagctctaccatttcatcaagatccccactgacaccgagtatttgttt
tacgtgctgtctttctgtaaaagtgcgtccatcccactgactgtggttgccctgattccc
tactgtattcatatgttaatgaaaccaagtgccaaaaagcttaattag

DBGET integrated database retrieval system