KEGG   Bubalus bubalis (water buffalo): 102401735Help
Entry
102401735         CDS       T05912                                 

Gene name
TSC1
Definition
(RefSeq) hamartin isoform X1
  KO
K07206  tuberous sclerosis 1
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04072  Phospholipase D signaling pathway
bbub04140  Autophagy - animal
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04211  Longevity regulating pathway
bbub04218  Cellular senescence
bbub04714  Thermogenesis
bbub04910  Insulin signaling pathway
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    102401735 (TSC1)
   04151 PI3K-Akt signaling pathway
    102401735 (TSC1)
   04152 AMPK signaling pathway
    102401735 (TSC1)
   04150 mTOR signaling pathway
    102401735 (TSC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102401735 (TSC1)
  09143 Cell growth and death
   04218 Cellular senescence
    102401735 (TSC1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102401735 (TSC1)
  09149 Aging
   04211 Longevity regulating pathway
    102401735 (TSC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102401735 (TSC1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102401735 (TSC1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102401735 (TSC1)
   05163 Human cytomegalovirus infection
    102401735 (TSC1)
   05165 Human papillomavirus infection
    102401735 (TSC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hamartin ATG16
Motif
Other DBs
NCBI-GeneID: 102401735
NCBI-ProteinID: XP_006062226
LinkDB All DBs
Position
12
AA seq 1158 aa AA seqDB search
MAQQANIGELLSMLDSPLLSVRDDVTAVFKENLNSDRGPMLVNTLVDYYLETNSKPVLHI
LTTLQEPHDKHLLDKMNEYVGKAASRLSALLLLGHVVRLQPSWKHKLSQAPLLPSLLKCL
KMDTDVIVLTTGVLVLITMLPMIPQSGKQHLHDFFDIFGRLSSWCLKKPGHVTEVYLVHL
HASVYALFHRLYGMYPCNFVSFLRSHYSMKENLETFEEVVKPMMEHVRIHPELVTGSKDH
ELDPRRWKRLETHDVVIECAKISLDPTEASYEDGYSVSHQISARFPHRSADVSASSYVDT
QNSYGNATSTPYSTSRLTLNTPGQLPQTLSSPSTRLLAEPPQATLWSPSAVCGMTTPPTS
PGNVPPDLSHPYSKVFGTTAGGKGTPLGTPATSPPPAPPCHSDDYVHLSLPQATAPKKEE
RTDSARPCLHRQPHVPNDRGLEELHGGKGSVTLSDLPGFLGDLASEEDSIEKDKEEAAIS
KELSEITTADAEPLVPRGGFDSPFYRDSLPGCPRKTLSASSSTQGTSANPEPLNSSLDKS
GPDTPKQAFTPIDLPCGGTRESPAGNRERQASLEASILTPSPCKIPPQRGVGFGSGQPPP
YDHLFEVALPKTAHHFVSKKTEELLKKAKGSAEEDFTPSASPVEVLDRLIQQGADVHSKE
LNRLSLPSKSVDWTHFGGSPPSDEIRTLRNQLLLLHNQLLYERFKRQQHALRNRRLLRKV
IRASALEEHNAAMKDQLKLQEKDIQIWKISLQKEQARYNQLQEQRDTVVTQLHSQIRQLQ
HDREEFYNQSQELQTKLEDCRNMIAELRVELKKASSKVCHTELLLSQVSQKLSNSESVQQ
QMEFLNRQLLVLGEVNELYLEQLQNKHSDTTKEVEMMKAAYRKELEKNRSHVLQQNQRLD
TCQKRILELESHLAKKDHLLLEQKKYLEDVKLQARGQLQAAESRYEAQKRITQVFELEIL
DLYGKLEKDGLLKKLEEQKPEAAEAAEERLDYCQDGCSDSVTGHNEEAPGRNGETKPPRP
GGARGGGGGRGGGSSSELSTPEKPPNPRAGPFSSRWETVVGEPTSSTPATVGSLPSSESF
LGMKARELFRNKSESQCDEDGLTVGSLSETLKTELGKDSGVEARAPLTLDGPLPPAPKPD
SVGQLRIMDYNEAQLEHS
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcaagccaatattggggagctcctctccatgctggactctcctctgctgagt
gtgcgtgacgacgtaacagctgtctttaaagagaatctcaattctgaccgtggtccgatg
cttgtgaacaccctggtggattattatctggaaaccaactctaagcctgtattgcacatc
ctgactaccttgcaagagccccatgataagcacctcttggacaaaatgaatgaatacgtg
ggcaaggccgcctctcggttatccgccctcttgctactgggccacgtcgtgaggctgcag
ccatcatggaagcataagctctctcaagcacctcttttgccttctctactaaaatgtctc
aagatggacaccgatgtcattgtcctcacaacaggagtcttagtgttgataaccatgctc
ccaatgatcccgcagtcggggaaacagcaccttcatgatttctttgatatttttggccgt
ctttcgtcatggtgcctgaagaaaccaggccatgtgacagaagtctatctcgtccacctc
cacgccagcgtctacgctctcttccatcgcctgtatgggatgtacccttgcaactttgtc
tcctttctgcgttctcactacagtatgaaggaaaacctggagacttttgaagaagtggtc
aagccaatgatggagcatgtgcgaattcacccggaattagtgactggatccaaggaccat
gaactggaccctcgaaggtggaagagattagaaacacatgatgttgtcatagaatgtgcc
aaaatctctctggaccctacagaggcctcatatgaagatggctattctgtgtcccaccaa
atctcagcccgttttcctcaccgttcagccgatgtctccgccagctcttacgttgacaca
cagaatagctatgggaatgctacttctaccccctactctacttctcggctgacgttaaac
acgccagggcagctacctcagactctgagttccccgtcgacacggctgttagctgagccg
ccacaagctactctttggagcccatctgcagtttgtgggatgaccactcctccaacttct
cctggaaatgtcccacctgatctgtcacacccttacagtaaagtctttggtacaactgca
ggtgggaaaggaactcctctgggaacccctgcaacctctcctcctccagccccaccctgc
cattcggatgactacgtgcacctttcactcccacaggccacggcccccaagaaggaagag
agaacagactctgcaaggccctgtctacacagacaaccccatgttccgaatgacagagga
ttagaagagctgcacggaggcaagggatctgtcactctcagtgatcttccagggttttta
ggagacctggcttctgaagaagacagtattgagaaggataaagaagaagcggccatatct
aaagagctgtctgagatcacgacggccgatgccgagcccctggttcctcgaggaggcttc
gactcgcccttctaccgggacagtctgccgggctgcccgcggaagaccctttcagcttcc
tccagcactcagggcaccagcgcgaaccctgagcctttaaactcctccctggacaagtcg
gggcctgacacaccaaagcaagccttcacgcccatagacctgccctgcggaggcaccagg
gagagccctgccggaaacagggagcgccaggcctctctggaggccagcatcctcaccccc
agcccctgtaaaattccacctcagaggggagtggggtttggcagtgggcagcctccccca
tacgatcatctttttgaggtggcattgccaaagactgcccatcattttgtcagcaagaag
acggaggaactgctcaagaaggcaaagggaagtgcagaggaggacttcacgccctccgcc
tcccctgtggaagtgctggacaggctgatacagcagggagcggatgtgcacagcaaggag
ctcaacaggttgtctttacccagcaagtctgtcgactggacccacttcggaggctctcct
ccctcagatgagatccgcaccctccgtaaccagttgcttttactgcacaaccagttactc
tacgagcgtttcaagcggcagcagcacgcgctgcgcaacaggcggctcctgcgcaaggtg
atccgggcctcggctctggaggagcacaacgctgccatgaaagaccagttgaagttgcaa
gagaaagacatccagatatggaagattagtctgcagaaagaacaagccaggtacaatcag
cttcaggagcagcgagacacagtggtcacccagcttcatagccagatcagacagcttcag
cacgaccgggaggagttctacaaccagagccaggagctacagacgaagctggaggactgc
aggaacatgatcgcagagctgcgcgtggaactgaagaaggccagcagcaaggtgtgccac
accgagctgctgctcagccaggtgtcccagaagctctcaaatagtgagtcggtccaacag
cagatggagttcttgaacaggcaactgttggttcttggggaagtcaacgagctgtatttg
gaacagctgcagaacaagcattcagacaccaccaaggaagtagaaatgatgaaggctgca
tatcggaaagagctagaaaaaaacagaagccacgtcctccagcagaatcagaggcttgat
acctgtcagaagcggattttggaactggaatctcatctggctaagaaagaccaccttctt
ttagaacagaaaaagtatctagaggatgtcaaactccaggcaagaggacagctacaggct
gcagagagcaggtatgaggcccagaagaggatcacccaggtgtttgaattggagatctta
gatttatacggcaagttggagaaggatggcctcctgaaaaaacttgaagaacaaaaacca
gaagcagctgaagcagcagaagaaaggcttgactactgtcaggacggctgctcggattcg
gtgacagggcacaacgaagaggcccctggccgtaacggtgagaccaagccccccaggccc
ggcggcgcccggggcggcggcggcggcagaggtggcggcagcagcagcgagctctccacc
ccggagaagccccccaaccccagggcgggcccgttcagcagtcggtgggagacggtggtg
ggtgagcccacttccagcacccccgcgactgtgggctcacttcccagctcagagagcttc
ctgggcatgaaggcacgagagctgtttcgtaacaagagcgagagccagtgtgacgaggat
ggcctgactgtcggcagcctttccgagaccctaaagacagagctgggcaaagactcgggt
gtggaggccagggcccccctgacccttgatggcccgctgccgcctgccccaaagccggac
agcgtgggccagctccgcatcatggactacaacgaggcccagcttgagcacagctag

DBGET integrated database retrieval system