KEGG   Bubalus bubalis (water buffalo): 102401862Help
Entry
102401862         CDS       T05912                                 

Gene name
ABL1
Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04110  Cell cycle
bbub04360  Axon guidance
bbub04722  Neurotrophin signaling pathway
bbub05200  Pathways in cancer
bbub05206  MicroRNAs in cancer
bbub05220  Chronic myeloid leukemia
bbub05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102401862 (ABL1)
   04012 ErbB signaling pathway
    102401862 (ABL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102401862 (ABL1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102401862 (ABL1)
  09158 Development and regeneration
   04360 Axon guidance
    102401862 (ABL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102401862 (ABL1)
   05206 MicroRNAs in cancer
    102401862 (ABL1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102401862 (ABL1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102401862 (ABL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102401862 (ABL1)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102401862 (ABL1)
Protein kinases [BR:bbub01001]
 Non-receptor tyrosine kinases
  ABL family
   102401862 (ABL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F_actin_bind SH2 SH3_1 SH3_9 SH3_2 SH3_3 Haspin_kinase SH3_6
Motif
Other DBs
NCBI-GeneID: 102401862
NCBI-ProteinID: XP_006043364
LinkDB All DBs
Position
12
AA seq 1151 aa AA seqDB search
MGQQPGKVLGDQRRPSLPALHFIKGAGKKESSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRDCNRQEVNAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDIWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKKGMRGVAGT
LLQAPELPTKTRTSRRAAEHKDSPDMPETPHSKGPGETDPVDHEPSVSPLLPRKERGPPD
GGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGPPERKAASEEEGREI
SNGALAPAPLDAAESAKSPKPNGGAGVPNGAFRESGGAGFRSPHLWKKSSTLTSSRLAAG
EEESGGGASKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPA
LPRKRASENRSDQMTRGTVTPPPRLVKKTEEAADEVFKDAAEASPGSSPPSLTPKPLRRQ
GAAAPPSSPPHKEEAGRPSAAGTPTELAPPTSRAGPGASGGPSKAASTAAEEPRGRRHKP
ASESPGRDKGKLSKLKPAPPPPPPTSTGKAGKSSQSQSQEAAGEAGAGAKVKPAALAADA
VNSDTAKSGQLGDGAKKPVLPSMPKPPASTKPVGTPTSPAPTPATLPSAPSALAGDQPSS
TAFIPLISTRVSLRKTRQPPERIASGAITKGMVLDGTEALCLAISKNSEQMASHSAVLEA
GKNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGGGPAATQDFSKLLS
SVKEISDIVQR
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcagcctggaaaagttcttggggaccaaaggaggccaagtctgcctgccctg
cactttatcaaaggagcaggcaagaaggaatcatcgaggcacgggggtccacactgcaat
gtttttgtggaacacgaagcccttcagaggccagtagcatctgacttcgagccccaaggt
ctgagcgaagcagctcgttggaactctaaggaaaaccttcttgctggtcccagtgaaaat
gaccccaaccttttcgttgcactgtatgactttgtggccagtggggataacactttaagc
ataactaaaggtgaaaagctccgggtcttaggctacaatcacaatggggagtggtgtgaa
gcccaaaccaaaaatggccaaggctgggtcccaagcaactacatcacaccggtcaacagc
ctggagaagcactcctggtaccacgggcctgtgtcccgcaacgccgctgagtaccttctg
agcagtgggatcaacggcagcttcttggttcgggagagtgagagtagtcctgggcagagg
tccatctcactgagatacgaaggaagggtgtaccactaccgaatcaacactgcttctgat
ggcaagctctacgtctcctctgagagccgcttcaacacattggccgagctggtccatcac
cactccactgtggccgacgggctcatcaccactctccactacccggcccccaagcgcaac
aagcccaccgtctacggcgtgtcccccaactacgacaagtgggagatggagcgcacggac
atcaccatgaagcacaagctggggggcggccagtacggggaggtgtacgaaggcgtgtgg
aagaaatacagcctgacggtggctgtgaagaccctgaaggaggataccatggaggtggag
gagttcttgaaagaggctgcagtaatgaaagagatcaagcaccccaatttagtacagtta
ctcggggtctgcacgcgggagcccccgttctacataatcactgagttcatgacctatggg
aacctgctggactacctgagggactgtaaccggcaggaggtgaatgccgtggtgctgctg
tacatggccacgcagatctcgtccgccatggagtacctggagaagaaaaacttcatccac
agagatcttgctgcccgaaactgcctggtaggggaaaaccacttggtgaaggtggctgat
tttggcctgagcaggctgatgacaggggacacctacacagcccacgccggggccaagttc
cccatcaagtggacggcgcccgagagcctggcctacaacaagttctccatcaagtcggac
atctgggcatttggagtgttgctttgggaaattgctacctatggcatgtcaccttaccca
ggaattgacctgtcccaggtgtatgagctgctggagaaagactaccgcatggagcgcccg
gaaggctgcccagagaaggtctacgaactcatgcgagcatgttggcagtggaatccctcc
gaccggccctccttcgctgagatccaccaagcctttgaaacgatgttccaggaatccagc
atatcagacgaagtggaaaaggagttggggaagaagggcatgcgaggggttgcaggtacc
ctgctgcaggccccagaactgcccaccaagacaagaacctccaggagagctgctgagcac
aaagacagccccgacatgcccgagacaccccactccaagggcccaggagagactgatcct
gtggaccacgaaccatctgtatctccactgctccctcgaaaagaacggggtcctccggat
ggcggcctcaatgaggatgagcgcctgcttcccaaagacaagaagaccaacctgttcagc
gccttgatcaagaagaagaagaaaaccgccccgacccctcccaaacgcagcagctccttc
cgggagatggatggcccgcccgagcggaaagcggccagtgaggaggaaggccgggaaatc
agcaacggggcgctggcaccagcacccctggatgcagcagagtcggccaagtccccaaag
cccaacggcggggccggggtccccaacggagccttccgggagtctgggggcgcaggcttc
cggtcgccccacctgtggaaaaagtccagcactctgaccagcagccggctggctgccggt
gaagaggagagcggtggcggcgccagcaagcgctttctgaggtcctgctcggcctcctgc
gtgccccatggcgccaaggacacagagtggcggtcagtcaccctgcctcgggacctgcag
tccaccggcaggcagttcgactcgtccaccttcggaggccacaaaagcgagaagccggcc
ttgcctcggaagcgggcaagcgagaacaggtctgaccagatgaccagaggcacggttacc
ccgccgccccggctggtgaagaaaaccgaggaggccgccgacgaggtcttcaaggacgcg
gctgaggccagtccaggctccagcccacccagcctgacgccaaaaccgctccggaggcag
ggtgcggccgcgcctccctccagccctccccacaaggaggaggccggcaggcccagtgct
gcggggacgcccactgagctggcaccccccaccagccgggcagggccaggagcctccgga
gggcccagcaaggctgcctccactgctgcagaggagccccgggggaggaggcacaagccc
gcctccgagtccccagggagagacaaggggaagctgtccaagctcaaacctgccccgcca
cccccgccacccacctccactggcaaagccgggaagtcctcgcagagccagagccaggaa
gcggccggggaggcaggcgccggggcaaaggtgaaacccgcagctctggctgcggatgcc
gtgaacagcgacaccgccaagtctggccagctgggagacggcgccaagaagcccgtgctc
ccatccatgccaaagccgccggcatccaccaagcccgtggggaccccgaccagccccgcc
cccacccccgccaccttgccgtcagcaccctctgccctggcaggggaccagccgtcctcc
accgccttcatcccgctcatatcgacccgcgtgtctcttcggaaaacccggcagcctccc
gagcggatcgccagtggcgccatcaccaagggcatggtgctggatggcacggaggccctg
tgcctggccatctccaagaactctgagcagatggccagccacagcgccgtgctcgaagcc
ggcaaaaacctctacacattctgcgtgagctatgtggactccatccagcaaatgaggaac
aaattcgccttccgcgaggccatcaacaaactggagaacaacctccgggagctgcaaatc
tgcccagcaaccgcaggtggtggcccagcggccactcaggacttcagcaaactcctcagc
tccgtgaaggagatcagcgacatcgtgcagaggtag

DBGET integrated database retrieval system