KEGG   Bubalus bubalis (water buffalo): 102401934
Entry
102401934         CDS       T05912                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04010  MAPK signaling pathway
bbub04064  NF-kappa B signaling pathway
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04115  p53 signaling pathway
bbub04210  Apoptosis
bbub04218  Cellular senescence
bbub05169  Epstein-Barr virus infection
bbub05200  Pathways in cancer
bbub05202  Transcriptional misregulation in cancer
bbub05210  Colorectal cancer
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05216  Thyroid cancer
bbub05217  Basal cell carcinoma
bbub05218  Melanoma
bbub05220  Chronic myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102401934 (GADD45A)
   04064 NF-kappa B signaling pathway
    102401934 (GADD45A)
   04068 FoxO signaling pathway
    102401934 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102401934 (GADD45A)
   04210 Apoptosis
    102401934 (GADD45A)
   04115 p53 signaling pathway
    102401934 (GADD45A)
   04218 Cellular senescence
    102401934 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102401934 (GADD45A)
   05202 Transcriptional misregulation in cancer
    102401934 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102401934 (GADD45A)
   05212 Pancreatic cancer
    102401934 (GADD45A)
   05225 Hepatocellular carcinoma
    102401934 (GADD45A)
   05226 Gastric cancer
    102401934 (GADD45A)
   05214 Glioma
    102401934 (GADD45A)
   05216 Thyroid cancer
    102401934 (GADD45A)
   05220 Chronic myeloid leukemia
    102401934 (GADD45A)
   05217 Basal cell carcinoma
    102401934 (GADD45A)
   05218 Melanoma
    102401934 (GADD45A)
   05213 Endometrial cancer
    102401934 (GADD45A)
   05224 Breast cancer
    102401934 (GADD45A)
   05222 Small cell lung cancer
    102401934 (GADD45A)
   05223 Non-small cell lung cancer
    102401934 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102401934 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bbub03036]
    102401934 (GADD45A)
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102401934 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102401934 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 102401934
NCBI-ProteinID: XP_006057574
LinkDB
Position
6
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDIDILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcaaaagaccgaaaggatggataaggtggga
gatgccctcgaggaagtgctcagcaaagccctgagtcagcgcaccatcaccgtcggggtg
tacgaggcggccaagctgctcaacgtcgacccggataacgtggtgctgtgcctgctggcg
gcggacgaggacgacgacagggacgtggctctgcagatccacttcaccctgatccaggca
ttctgctgcgagaatgatatcgacatcctgcgtgtcagcaacccgggccggctggccgaa
ctcttgctcctggagaccgatgcgggccccgcggccagcgagggcgcagagcagcccccg
gacctgcactgcgtgctggtgacgaatccgcattcatcacagtggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggttccagtgatt
aatctccctgaacggtga

KEGG   Bubalus bubalis (water buffalo): 102410115
Entry
102410115         CDS       T05912                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04010  MAPK signaling pathway
bbub04064  NF-kappa B signaling pathway
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04115  p53 signaling pathway
bbub04210  Apoptosis
bbub04218  Cellular senescence
bbub05169  Epstein-Barr virus infection
bbub05200  Pathways in cancer
bbub05202  Transcriptional misregulation in cancer
bbub05210  Colorectal cancer
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05216  Thyroid cancer
bbub05217  Basal cell carcinoma
bbub05218  Melanoma
bbub05220  Chronic myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102410115 (GADD45B)
   04064 NF-kappa B signaling pathway
    102410115 (GADD45B)
   04068 FoxO signaling pathway
    102410115 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102410115 (GADD45B)
   04210 Apoptosis
    102410115 (GADD45B)
   04115 p53 signaling pathway
    102410115 (GADD45B)
   04218 Cellular senescence
    102410115 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102410115 (GADD45B)
   05202 Transcriptional misregulation in cancer
    102410115 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102410115 (GADD45B)
   05212 Pancreatic cancer
    102410115 (GADD45B)
   05225 Hepatocellular carcinoma
    102410115 (GADD45B)
   05226 Gastric cancer
    102410115 (GADD45B)
   05214 Glioma
    102410115 (GADD45B)
   05216 Thyroid cancer
    102410115 (GADD45B)
   05220 Chronic myeloid leukemia
    102410115 (GADD45B)
   05217 Basal cell carcinoma
    102410115 (GADD45B)
   05218 Melanoma
    102410115 (GADD45B)
   05213 Endometrial cancer
    102410115 (GADD45B)
   05224 Breast cancer
    102410115 (GADD45B)
   05222 Small cell lung cancer
    102410115 (GADD45B)
   05223 Non-small cell lung cancer
    102410115 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102410115 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bbub03036]
    102410115 (GADD45B)
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102410115 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102410115 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 102410115
NCBI-ProteinID: XP_006047893
LinkDB
Position
9
AA seq 160 aa
MTLEELVACDNAAQKMQTVSAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDTWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacactggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgagc
gccgcggtggaggagttgctggtggccgcgcagcgccaggaccgcctcaccgtgggggtg
tacgagtcggccaagctgatgaatgtggatcccgacagcgtggtcctgtgccttctggcc
atcgacgaggaagaggaggacgacatcgccctgcagatccacttcacgcttattcagtcc
ttctgctgcgacaacgacatcgacatcgtgcgggtgtcggggatgcagcgcctggcgcag
ctgctgggcgagccggccgagacccagggcaccaccgaggcccgggacctgcactgtctc
ctggtcacgaaccctcacacagacacctggaaaagccacggcctggtggaggtggccagt
tactgcgaagaaagtagggggaacaaccagtgggttccctacatctccctccaggagcgc
tga

KEGG   Bubalus bubalis (water buffalo): 102410587
Entry
102410587         CDS       T05912                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04010  MAPK signaling pathway
bbub04064  NF-kappa B signaling pathway
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04115  p53 signaling pathway
bbub04210  Apoptosis
bbub04218  Cellular senescence
bbub05169  Epstein-Barr virus infection
bbub05200  Pathways in cancer
bbub05202  Transcriptional misregulation in cancer
bbub05210  Colorectal cancer
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05216  Thyroid cancer
bbub05217  Basal cell carcinoma
bbub05218  Melanoma
bbub05220  Chronic myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102410587 (GADD45G)
   04064 NF-kappa B signaling pathway
    102410587 (GADD45G)
   04068 FoxO signaling pathway
    102410587 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102410587 (GADD45G)
   04210 Apoptosis
    102410587 (GADD45G)
   04115 p53 signaling pathway
    102410587 (GADD45G)
   04218 Cellular senescence
    102410587 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102410587 (GADD45G)
   05202 Transcriptional misregulation in cancer
    102410587 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102410587 (GADD45G)
   05212 Pancreatic cancer
    102410587 (GADD45G)
   05225 Hepatocellular carcinoma
    102410587 (GADD45G)
   05226 Gastric cancer
    102410587 (GADD45G)
   05214 Glioma
    102410587 (GADD45G)
   05216 Thyroid cancer
    102410587 (GADD45G)
   05220 Chronic myeloid leukemia
    102410587 (GADD45G)
   05217 Basal cell carcinoma
    102410587 (GADD45G)
   05218 Melanoma
    102410587 (GADD45G)
   05213 Endometrial cancer
    102410587 (GADD45G)
   05224 Breast cancer
    102410587 (GADD45G)
   05222 Small cell lung cancer
    102410587 (GADD45G)
   05223 Non-small cell lung cancer
    102410587 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102410587 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bbub03036]
    102410587 (GADD45G)
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102410587 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102410587 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 102410587
NCBI-ProteinID: XP_006054004
LinkDB
Position
3
AA seq 159 aa
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGTGDESGAPVDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPNITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagttcgtggccaggacacggttccagaaagcacagccaggatgcag
ggcgccgggaaagcgttgcacgagctgctgttgtcggcgcagcgccaaggctgcctcacg
gccggcgtctacgagtcagccaaagtcctgaacgtggaccccgacaatgtgaccttctgc
gtgctagccgctgacgaggaggacgagggcgatatcgcgctgcagatccacttcactttg
atccaagcgttctgctgtgagaacgacatagacatcgtgcgcgtgggcgacgtgcagcgg
ctggcggcgatcgtgggtaccggcgacgagtcgggggcacctgtagacctgcactgtatc
ctcatttcgaaccccaatgaggacgcatggaaggaccccgccttggagaaacttagcctg
ttctgcgaggagagccgcagcgtcaacgactgggtgcctaatatcacccttcccgagtga

DBGET integrated database retrieval system