KEGG   Bubalus bubalis (water buffalo): 102402069
Entry
102402069         CDS       T05912                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01522  Endocrine resistance
bbub01524  Platinum drug resistance
bbub04010  MAPK signaling pathway
bbub04071  Sphingolipid signaling pathway
bbub04110  Cell cycle
bbub04115  p53 signaling pathway
bbub04137  Mitophagy - animal
bbub04151  PI3K-Akt signaling pathway
bbub04210  Apoptosis
bbub04211  Longevity regulating pathway
bbub04216  Ferroptosis
bbub04218  Cellular senescence
bbub04310  Wnt signaling pathway
bbub04722  Neurotrophin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub05012  Parkinson disease
bbub05014  Amyotrophic lateral sclerosis
bbub05016  Huntington disease
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05169  Epstein-Barr virus infection
bbub05200  Pathways in cancer
bbub05202  Transcriptional misregulation in cancer
bbub05203  Viral carcinogenesis
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05216  Thyroid cancer
bbub05217  Basal cell carcinoma
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102402069 (TP53)
   04310 Wnt signaling pathway
    102402069 (TP53)
   04071 Sphingolipid signaling pathway
    102402069 (TP53)
   04151 PI3K-Akt signaling pathway
    102402069 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102402069 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    102402069 (TP53)
   04210 Apoptosis
    102402069 (TP53)
   04216 Ferroptosis
    102402069 (TP53)
   04115 p53 signaling pathway
    102402069 (TP53)
   04218 Cellular senescence
    102402069 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102402069 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102402069 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    102402069 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102402069 (TP53)
   05202 Transcriptional misregulation in cancer
    102402069 (TP53)
   05206 MicroRNAs in cancer
    102402069 (TP53)
   05205 Proteoglycans in cancer
    102402069 (TP53)
   05203 Viral carcinogenesis
    102402069 (TP53)
   05230 Central carbon metabolism in cancer
    102402069 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102402069 (TP53)
   05212 Pancreatic cancer
    102402069 (TP53)
   05225 Hepatocellular carcinoma
    102402069 (TP53)
   05226 Gastric cancer
    102402069 (TP53)
   05214 Glioma
    102402069 (TP53)
   05216 Thyroid cancer
    102402069 (TP53)
   05220 Chronic myeloid leukemia
    102402069 (TP53)
   05217 Basal cell carcinoma
    102402069 (TP53)
   05218 Melanoma
    102402069 (TP53)
   05219 Bladder cancer
    102402069 (TP53)
   05215 Prostate cancer
    102402069 (TP53)
   05213 Endometrial cancer
    102402069 (TP53)
   05224 Breast cancer
    102402069 (TP53)
   05222 Small cell lung cancer
    102402069 (TP53)
   05223 Non-small cell lung cancer
    102402069 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102402069 (TP53)
   05014 Amyotrophic lateral sclerosis
    102402069 (TP53)
   05016 Huntington disease
    102402069 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102402069 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102402069 (TP53)
   05161 Hepatitis B
    102402069 (TP53)
   05160 Hepatitis C
    102402069 (TP53)
   05162 Measles
    102402069 (TP53)
   05168 Herpes simplex virus 1 infection
    102402069 (TP53)
   05163 Human cytomegalovirus infection
    102402069 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102402069 (TP53)
   05169 Epstein-Barr virus infection
    102402069 (TP53)
   05165 Human papillomavirus infection
    102402069 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102402069 (TP53)
   01522 Endocrine resistance
    102402069 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbub03000]
    102402069 (TP53)
   03036 Chromosome and associated proteins [BR:bbub03036]
    102402069 (TP53)
   03400 DNA repair and recombination proteins [BR:bbub03400]
    102402069 (TP53)
Transcription factors [BR:bbub03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    102402069 (TP53)
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102402069 (TP53)
DNA repair and recombination proteins [BR:bbub03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102402069 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD DEC-1_N
Other DBs
NCBI-GeneID: 102402069
NCBI-ProteinID: NP_001277773
UniProt: F6MDM8
LinkDB
Position
3
AA seq 386 aa
MEESQAELNVEPPLSQETFSDLWNLLPENNLLSSELSAPVDDLLPYTDVATWLDECPNEV
PQMPEPSAPAAPPPATPAPATSWPLSSFVPSQKTYPGNYGFRLGFLHSGTAKSVTCTYSP
SLNKLFCQLAKTCPVQLWVDSPPPPGTRVRAMAIYKKLEHMTEVVRRCPHHERSSDYSDG
LAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYESPEIDSECTTIHYNFMCNSSCMGGMN
RRPILTIITLEDSCGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGQSCPEPPPGSTKRA
LPTNTSSSPQQKKKRLDEEYFTLQIRGLKRYEMFRELNDALELKDALDGREPGESRAHSS
HLKSKKRPSPSCHKKPMLKREGPDSD
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggaagaatcacaggcagaactcaatgtggagccccctctgagtcaggagacattttcc
gacttgtggaacctacttcctgaaaataaccttctgtcctccgagctctctgcacctgtg
gatgacctgctcccgtacacagatgttgccacctggctggatgaatgtccgaatgaagtg
ccccaaatgccagagccttctgctccagctgccccgccaccagccaccccagcaccagcc
acctcctggcccctgtcatcctttgtcccctcccagaagacctaccctggcaattacggt
ttccgtctagggttcctgcattccggaacagccaagtctgtgacctgcacgtattcccct
tcccttaacaagctgttctgtcagctggccaagacctgcccagtgcagctgtgggtcgac
tcgccacccccgcccggcacccgcgtccgcgccatggccatctacaagaagttggagcac
atgacggaggttgtgaggcgttgtccccaccatgagcgctcctctgactatagcgatggt
ctggcccctcctcagcaccttatccgggtggaagggaatttacgcgcagagtatttggac
gaccggaacacctttagacacagtgtggtggtgccctatgagtcccccgagatcgactct
gagtgcaccaccatccattacaacttcatgtgtaacagctcctgtatggggggcatgaac
cggcggcccatcctcaccatcatcacactggaagactcttgtggtaacctgctgggacgg
aacagctttgaggtgcgagtttgtgcctgtcctgggagagaccgccgcactgaggaagaa
aattttcgcaagaaggggcagtcttgccccgagccaccccctgggagcactaagcgagca
ctgcctaccaacaccagctcctctccacagcaaaagaagaaacgactggatgaagagtat
ttcactcttcagatccgtgggcttaaacgctatgagatgttccgagagctgaatgatgcc
ttggagctgaaggatgctctggatggaagggaaccaggggaaagcagggctcactctagc
cacctgaagtctaagaagaggccttctccctcctgccataaaaaaccaatgctcaagaga
gaggggcctgactcagactga

DBGET integrated database retrieval system