KEGG   Bubalus bubalis (water buffalo): 102402664
Entry
102402664         CDS       T05912                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04110  Cell cycle
bbub04151  PI3K-Akt signaling pathway
bbub04218  Cellular senescence
bbub04310  Wnt signaling pathway
bbub04350  TGF-beta signaling pathway
bbub04390  Hippo signaling pathway
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04630  JAK-STAT signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub05132  Salmonella infection
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05163  Human cytomegalovirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05169  Epstein-Barr virus infection
bbub05200  Pathways in cancer
bbub05202  Transcriptional misregulation in cancer
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05213  Endometrial cancer
bbub05216  Thyroid cancer
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05222  Small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102402664 (MYC)
   04012 ErbB signaling pathway
    102402664 (MYC)
   04310 Wnt signaling pathway
    102402664 (MYC)
   04350 TGF-beta signaling pathway
    102402664 (MYC)
   04390 Hippo signaling pathway
    102402664 (MYC)
   04630 JAK-STAT signaling pathway
    102402664 (MYC)
   04151 PI3K-Akt signaling pathway
    102402664 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102402664 (MYC)
   04218 Cellular senescence
    102402664 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102402664 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102402664 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102402664 (MYC)
   05202 Transcriptional misregulation in cancer
    102402664 (MYC)
   05206 MicroRNAs in cancer
    102402664 (MYC)
   05205 Proteoglycans in cancer
    102402664 (MYC)
   05230 Central carbon metabolism in cancer
    102402664 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102402664 (MYC)
   05225 Hepatocellular carcinoma
    102402664 (MYC)
   05226 Gastric cancer
    102402664 (MYC)
   05216 Thyroid cancer
    102402664 (MYC)
   05221 Acute myeloid leukemia
    102402664 (MYC)
   05220 Chronic myeloid leukemia
    102402664 (MYC)
   05219 Bladder cancer
    102402664 (MYC)
   05213 Endometrial cancer
    102402664 (MYC)
   05224 Breast cancer
    102402664 (MYC)
   05222 Small cell lung cancer
    102402664 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102402664 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102402664 (MYC)
   05161 Hepatitis B
    102402664 (MYC)
   05160 Hepatitis C
    102402664 (MYC)
   05163 Human cytomegalovirus infection
    102402664 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102402664 (MYC)
   05169 Epstein-Barr virus infection
    102402664 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbub03000]
    102402664 (MYC)
   03019 Messenger RNA biogenesis [BR:bbub03019]
    102402664 (MYC)
Transcription factors [BR:bbub03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    102402664 (MYC)
Messenger RNA biogenesis [BR:bbub03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     102402664 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 102402664
NCBI-ProteinID: NP_001277829
UniProt: G9JZK3
LinkDB
Position
15
AA seq 439 aa
MPLNVSFANKNYDLDYDSVQPYFYCDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVASFSPRGDDDGGGGSFSSADRLEMVTELLGGDMVNQSFICDPD
DETLIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDGGSPSPARGHGGCSTSSLYLQD
LSAAASECIDPSVVFPYPLHDSSSPKPCASPDSTAFSPSSDSLLSSAESSPRASPEPLAL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSAGSHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEHKLLSEKDVL
RKRREQLKLKLEQIRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacaagaactatgacctcgactacgattcagtgcag
ccttatttctactgcgacgaggaggagaacttctaccaccagcagcagcagagcgaactg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtcccctagccgccgctccgggctctgctcgccgtcgtacgtcgcggtcgcctccttc
tcgcccaggggagacgacgacggcggcggcggcagcttctcctccgcggaccggttggag
atggtgaccgagctgctgggaggcgacatggtgaaccagagcttcatttgcgaccccgac
gatgagaccctcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcggcc
gccgccaagctagtctcggagaagctggcctcttaccaggctgcgcgcaaagacggcggc
agcccgagccccgcccgcgggcacggcggctgctccacctccagcttgtacctgcaggac
ctgagcgccgccgcctccgaatgcatcgacccctcggtggtcttcccctacccgctccac
gacagcagctcgcccaagccctgcgcctccccggactccaccgccttttctccgtcctct
gactctctgctctcctctgctgagtcctccccgcgggccagtcccgagcccctggcgctc
catgaggagaccccacccacgaccagtagcgactctgaggaagaacaagaggatgaggaa
gaaattgatgttgtttctgtggaaaagaggcagccccctgccaaaaggtcagaatcgggg
tcaccctctgcaggcagccacagcaaacctcctcacagcccgttagtcctaaagagatgc
cacgtgtctacccatcagcacaattacgcagcgcccccctccactaggaaggactatccc
gccgccaagagggctaagttggacagtggcagggtcctgaaacagataagcaacaaccgc
aaatgtgccagcccgaggtcttcggacacggaggagaatgacaagaggcggacacacaac
gttttggagcgccagaggagaaacgagctgaaacgcagcttttttgctcttcgtgaccag
atcccagagttggagaacaatgaaaaagcccccaaggtagttatccttaaaaaagccaca
gcgtacatcctgtcggtccaagcagaggagcacaagctcctgtcagaaaaagacgtgttg
cggaagaggcgagaacagttgaaactcaaacttgaacagatacggaactcttgcgcctaa

DBGET integrated database retrieval system