KEGG   Bubalus bubalis (water buffalo): 102403077
Entry
102403077         CDS       T05912                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01522  Endocrine resistance
bbub01524  Platinum drug resistance
bbub04012  ErbB signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04115  p53 signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04218  Cellular senescence
bbub04630  JAK-STAT signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04928  Parathyroid hormone synthesis, secretion and action
bbub04934  Cushing syndrome
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05169  Epstein-Barr virus infection
bbub05200  Pathways in cancer
bbub05202  Transcriptional misregulation in cancer
bbub05203  Viral carcinogenesis
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05216  Thyroid cancer
bbub05217  Basal cell carcinoma
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102403077 (CDKN1A)
   04630 JAK-STAT signaling pathway
    102403077 (CDKN1A)
   04066 HIF-1 signaling pathway
    102403077 (CDKN1A)
   04068 FoxO signaling pathway
    102403077 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    102403077 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102403077 (CDKN1A)
   04115 p53 signaling pathway
    102403077 (CDKN1A)
   04218 Cellular senescence
    102403077 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102403077 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    102403077 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102403077 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    102403077 (CDKN1A)
   05206 MicroRNAs in cancer
    102403077 (CDKN1A)
   05205 Proteoglycans in cancer
    102403077 (CDKN1A)
   05203 Viral carcinogenesis
    102403077 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102403077 (CDKN1A)
   05212 Pancreatic cancer
    102403077 (CDKN1A)
   05225 Hepatocellular carcinoma
    102403077 (CDKN1A)
   05226 Gastric cancer
    102403077 (CDKN1A)
   05214 Glioma
    102403077 (CDKN1A)
   05216 Thyroid cancer
    102403077 (CDKN1A)
   05220 Chronic myeloid leukemia
    102403077 (CDKN1A)
   05217 Basal cell carcinoma
    102403077 (CDKN1A)
   05218 Melanoma
    102403077 (CDKN1A)
   05211 Renal cell carcinoma
    102403077 (CDKN1A)
   05219 Bladder cancer
    102403077 (CDKN1A)
   05215 Prostate cancer
    102403077 (CDKN1A)
   05213 Endometrial cancer
    102403077 (CDKN1A)
   05224 Breast cancer
    102403077 (CDKN1A)
   05222 Small cell lung cancer
    102403077 (CDKN1A)
   05223 Non-small cell lung cancer
    102403077 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102403077 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102403077 (CDKN1A)
   05161 Hepatitis B
    102403077 (CDKN1A)
   05160 Hepatitis C
    102403077 (CDKN1A)
   05163 Human cytomegalovirus infection
    102403077 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102403077 (CDKN1A)
   05169 Epstein-Barr virus infection
    102403077 (CDKN1A)
   05165 Human papillomavirus infection
    102403077 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102403077 (CDKN1A)
   01522 Endocrine resistance
    102403077 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102403077
NCBI-ProteinID: XP_006050470
LinkDB
Position
2
AA seq 161 aa
MSELSRDAHQIPRSSKACRCLFGPVDSEQLRQDCDALMASCVQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPVGPRDDLGGGKRPSPSSALLQGTSQEDHLDLSLSCTLVTRS
PERPEGTPGGPGPSQGRKRRQTSMTDFYHSKRRLICSKRKP
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtccgagctgtccagggacgcgcatcaaatcccccgcagcagcaaggcctgccgctgc
ctctttggtccagtggacagcgagcagctgcgccaggactgcgacgccctcatggccagc
tgcgtgcaggaggcccgagagcggtggaacttcgactttgttaccgagacgccgctggag
ggggacttcgcctgggagcgcgtgaggggcctcggcctgcccaagctctacctgcccgtg
gggccccgagacgacctgggagggggcaagcggccgagcccctcgtccgccctgctgcag
ggcacgtctcaggaggaccacttggacctgtcgctgtcctgcaccctcgtgactcgctcc
cctgagcggcccgagggaacccccggtgggcctggcccctcccagggccggaaacggcgg
cagaccagcatgacagatttctaccactccaaacgcaggctgatctgctccaagaggaag
ccctaa

DBGET integrated database retrieval system