KEGG   Bubalus bubalis (water buffalo): 102403193
Entry
102403193         CDS       T05912                                 

Gene name
WDR62
Definition
(RefSeq) LOW QUALITY PROTEIN: WD repeat-containing protein 62
  KO
K21762  WD repeat-containing protein 62
Organism
bbub  Bubalus bubalis (water buffalo)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bbub03036]
    102403193 (WDR62)
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102403193 (WDR62)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A DUF5046
Other DBs
NCBI-GeneID: 102403193
NCBI-ProteinID: XP_006068824
LinkDB
Position
18
AA seq 1516 aa
MAALGPGGYARNDTVEKLPSVMAGVPARRAQSSPPPAPPLCLRRRTRLPAAPEDTVQNRV
SLEKVLGITAQNSSGLTCDPSTGHVAYLAGCVVVILNPKENKQQHILNTARKSLSALAFS
PDGKYIVTGENGHRPAVRIWDVEEKSQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMV
LNVWDWKKDILVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEVSTEAKVTGTVPL
VGRSGILGELHDNVFCGVACGRGQMAGSTFCVSYSGLLCQFNEKRVLEKWINLKVSLSSC
LCVSQELIFCGCTDGIVRIFQAHSLQYLTNLPKPHYLGVDVAQGLEPSFLFHRKAEATYP
DTVALTFDPTHQWLSCVYKDHSIYIWDVRDINQVGKVWSELFHSSYVWNVEVYPEFEDQR
ACLPSGSFLTCSSDNTIRFWNMDSNPDSQWQKNIFSNTLLKVVYVENDIQHLQDMSHFPD
RGSENAMPVDVKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELVKVEAHDAEVLCL
EYSKPETGLTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFTGNRDIQMISCG
ADKSIYFRSAQRASDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTMNG
KQKKCYKGSQGDDGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECVAKMFGHSEIVTG
MKFTYDCRHLITVSGDSCVFIWHLGPEITNCMKQHLLEIDHREQQQNTKDGKWSGHPRQE
IHASVPSEICSLSPGEQTEDELEEECESEELLKTPSKESLDPDPQCLLTNGKLPLWAKRL
LGDDDTADSTAFHAKRSYQPHGRWAERADQEPLKTILDARDLDCYFTPMKPESLEDSVLD
AMESQRLAGLLSESESPQEDGCGHPSLSPPQQESSEASELITCPLETEVTVTGMDSEYCA
EEVVEARGDQQGDPFLPVSSISSKDRSPPEDSGESEADLECSFTTIHSSPPQPDPEPQFD
TMPPIPGCPGTAGELPRPEVPGISNSSLPQTPEQEKFLRHHFETLTDAHPEELFLGSLRD
LKAPETEGDFFNPRLSISAQFLSRLQKTSRFPHAFPSRLPRHLVKSSEVRLTDLQGEPPT
AGAGSTSPVRTNVVPGGKAEETLEVWSPLSPCLTGLAPCIPSSSALPTDKKPPAPTALPA
AGLAQVLHTPTTCSHMEATASSHAKMSRSISLEELASLSKELQAVTTTVTHSSDSEGREP
ALPSRGNHEARASLKLSLSSICDRLLLPPPQLELPTTCVWSQEPVDTERFVTVTTDGFPA
HSPADGIASRLHKSAFLPRFLAPVRLDTPVLPNSPPLPEARPRVLGSIASLREPTPEVPS
PVQDCPGHWEDPRAPTSFLPPDPLELSNVGTVVHRLQAAFQEALDLYHLMVSSDEVNAEQ
RQARTELASTFLWIHSQLEASDWLVGMDVATAQAPPSPGAPSPPTLCPLASPDLRALLEH
YSELLVQAVRRKARGD
NT seq 4551 nt   +upstreamnt  +downstreamnt
atggcggccttggggcccggaggctacgcgcggaatgatacagttgagaagctgccatca
gtcatggcgggagttccggcgcggagggcccagtcttctccgcccccggctccaccgctt
tgcctccggcggcggacgcgactcccggcggctcccgaggacacggtgcagaatcgggta
tcactcgagaaggtgcttggcatcacggcccagaacagcagtggcctaacctgtgacccc
agcacaggccacgtggcctacctggcaggctgtgtggtggtgattttgaaccccaaggag
aacaagcagcagcacatccttaatactgccaggaagtctctgagcgctctggccttctcc
cctgatggaaagtacatagtgacgggggagaatgggcacaggcctgctgtacgtatctgg
gacgtggaagaaaagagtcaggtggcggaaatgctgggccacaagtacggcgtggcctgc
gtggccttctcccccaacatgaagcacattgtgtccatgggctaccagcacgacatggta
ctcaacgtctgggactggaagaaagacatcctggtggcctccaacaaggtatcgtgccgg
gtcattgccctctccttctcagaggacagcagctattttgtcactgtcgggaaccggcat
gtgaggttctggttcttggaagtgtccaccgaagcaaaggtgacgggcacggtgcccctg
gtggggcgctcaggcatcctgggtgagctgcatgacaacgtcttctgtggtgtggcttgt
ggccggggccagatggcaggcagtaccttctgtgtgtcctactcgggcctcctctgccag
ttcaacgagaagagggtgctggagaagtggatcaacctgaaggtctccctgtcttcctgc
ctctgtgtcagccaggagctcatcttctgtggctgcactgatgggatagtccgcatcttc
caagcccacagcctgcagtacctcaccaacctgcccaagccgcactacctgggggtggat
gtggcccagggcctggagcccagcttcctcttccacaggaaggcagaggccacctacccg
gatacagtggcgctgacctttgaccccacgcaccagtggctgtcctgcgtgtacaaggac
cacagcatctacatctgggatgtcagagacatcaaccaagtaggcaaggtgtggtcagag
ctcttccacagctcctacgtctggaacgtggaggtgtatcctgagtttgaagatcagaga
gcttgtctaccatcaggatcttttctgacttgttcctcagacaataccatccgcttctgg
aacatggacagcaaccctgactctcaatggcagaagaacatcttcagtaataccctgctg
aaggtcgtgtatgtggagaacgacatccagcacctgcaggacatgtcacacttcccagac
cgggggagcgagaatgcgatgcccgtggacgtgaaagctggtgttcgagtcatgcaggtc
agtcctgatggccaacacttggcttcaggcgaccgaagtggaaatctgaggatccacgag
ctgcacttcatggacgagctggtcaaggtggaggcccacgatgctgaggtgctgtgcctg
gagtactctaagccagagacagggctgactttacttgcctcggccagtcgggaccgactg
atccacgtgctgaacgtggagaagaactacaacctggagcagaccttggatgaccactcc
tcatccatcacggccatcaagttcactggcaacagagacatccagatgatcagctgtggc
gccgacaagagcatctacttccgcagtgcccagcgggcctcggatggactgcactttgtc
cgtacccaccacgtggctgagaagactactttgtatgacatggacatcgacattacccag
aagtacgtggccgtggcctgccaggaccgcaacgtgagagtctacaacaccatgaacggg
aagcagaagaagtgctacaagggctcccagggtgatgacgggtccctgctgaaggtccac
gtggacccctctggcaccttcctggccaccagctgctctgacaaaagcatctcagtgatt
gacttctactcaggcgagtgtgttgccaagatgtttggccattcagaaattgtcactggc
atgaagttcacctatgattgccgtcacttgatcaccgtgtccggagacagctgtgtcttc
atctggcacctgggccctgagatcaccaactgcatgaagcagcacttgctggagatcgac
caccgggagcagcagcagaacacgaaggacgggaagtggagcggccaccccaggcaggag
atacatgcatccgtgcctagtgagatttgttccctgagccctggagagcagacggaggat
gagctggaggaagaatgtgaatctgaagagctgctgaagaccccatccaaggagagcttg
gatccagatcctcagtgccttctgaccaacggcaagctgccgctctgggcaaagcggctg
ctaggagatgacgacacagcagacagcacggccttccatgccaagcgcagctaccagccg
catggccgctgggcagagcgggctgaccaggagcctcttaagaccatcctggatgccagg
gacctggactgctactttacccccatgaagcccgagagcctggaggattccgtcctggat
gcgatggagtcgcagagactggcaggcctgctgagcgagtccgagagtccccaggaggat
ggctgcgggcacccttccttgtcacccccacagcaggaatcttctgaggccagcgagctc
atcacctgtcccctggagacagaggtgacagtcacagggatggacagtgagtactgtgcg
gaggaggtagtggaggcacgcggagaccagcaaggggaccccttcctcccggtctcctca
atcagctcgaaggaccggagtccacctgaggactcgggggagtcagaggctgacttggag
tgcagcttcaccaccatccattcctcccctccacagccagacccagaacctcagtttgac
acaatgccccccataccaggatgcccagggactgcaggagagttgccccggcccgaggtg
ccaggcatatccaacagctccctgccccagacccctgagcaagagaagttcctccgccac
cacttcgagacgcttactgatgcccaccctgaggagctcttcctcggatccctgagagac
ctgaaagcccctgagaccgagggtgacttcttcaacccccgactgagcatctcagcccag
ttcctctcccgccttcagaagacatccaggtttccccacgccttcccttcccgactgccc
cggcacctcgtgaagtcctcggaggtcagactcacggacctccagggcgagcccccaaca
gcgggtgctggctccacctccccagtcaggaccaacgtcgtccctggaggaaaggctgag
gagacgctggaggtgtggtccccactgtccccctgcctcacgggcctggcgccctgcatc
ccctcctcctctgcactgcccacagacaagaagccaccagcacccacggccctacccgct
gcaggcctggctcaggttctccacacccccaccacctgctcccacatggaggccactgcc
agttcccatgccaagatgtcccgcagcatttccctggaggagctggcctccctgagcaag
gagcttcaggctgtcaccaccacagtgacacacagttctgacagcgagggccgagaacct
gccctgccctcccggggcaaccatgaggcccgtgccagcctgaaactcagcctgtcgagc
atctgtgacaggctcttgctgcccccaccccaactggagcttcccaccacgtgtgtctgg
tcccaggagcctgtggatactgagcgctttgtcactgttacgacagatggtttcccagcc
cacagccctgcagatgggatcgcctctaggctccacaagtccgcctttctcccaaggttc
ctggcccctgtgcgcctcgatacccctgtcctccccaacagtcccccgctcccagaggcc
aggcctagggtccttggcagcatcgcctctctccgggagcccacccctgaagtgcccagt
ccagtccaggactgccctggacactgggaggaccccagggcgccaaccagcttcctgccc
ccagaccccctggagctgagcaacgtgggcactgtcgtgcacagactgcaggccgccttc
caggaagccctggacctttaccacctgatggtctccagtgatgaggtgaacgccgaacag
cggcaggcacgaactgagctggcctccactttcctctggatccacagccagttagaggcc
agcgactggctggtggggatggatgtggccacagcccaggccccgcccagcccaggtgcc
ccctccccgcctaccctgtgccccctggccagcccagatttgcgtgccctgctggaacac
tactcagagctgctggtgcaggccgtgaggaggaaggcgcgtggggactga

DBGET integrated database retrieval system