KEGG   Bubalus bubalis (water buffalo): 102403360Help
Entry
102403360         CDS       T05912                                 

Definition
(RefSeq) steroid 21-hydroxylase-like isoform X1
  KO
K00513  steroid 21-monooxygenase [EC:1.14.14.16]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00140  Steroid hormone biosynthesis
bbub01100  Metabolic pathways
bbub04925  Aldosterone synthesis and secretion
bbub04927  Cortisol synthesis and secretion
bbub04934  Cushing syndrome
Module
bbub_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102403360
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    102403360
   04927 Cortisol synthesis and secretion
    102403360
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102403360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bbub00199]
    102403360
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     102403360
Cytochrome P450 [BR:bbub00199]
 Cytochrome P450, animal type
  CYP21 family
   102403360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 102403360
NCBI-ProteinID: XP_025123486
LinkDB All DBs
Position
2
AA seq 327 aa AA seqDB search
MVLAGLLLLLTLLAGAHLLWGRWKLRNLHLPPLVPGFLHLLQPNLPIHLLSLTQKLGPVY
RLRLGLQEVVVLNSKRTIEEAMIRKWVDFAGRPQIPSYKLVSQRCQDISLGDYSLLWKAH
KKLTRSALLLGTRSSMEPWVDQLTQEFCERMRVQAGAPVTIQKEFCSIICYLTFGDKEDT
LVYAIHDYVQDLMKTWDHWSIQILDMVPFLRFFPNPGLWRLKQAIENRDHMVEKQLTRHK
ESMVAGQWRDMTDYMLQGVGRQRVEEGPGQLLEGHVHMSVVDLFIGGTETTASTLSWAVA
FLLHHPKACPGGGKGILPGSLARVAGT
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcgcagggctgctgctgctgctcaccctgctagccggcgctcacctgctgtgg
ggccggtggaagctcagaaacctccacctcccacctctggtccccggcttcctgcacctg
ctgcagcccaacctccccatccatctgctgagcctgactcagaaactcgggcctgtctac
aggcttcgccttgggctgcaagaggtggtggtgctgaactccaagaggaccattgaggag
gctatgatcaggaagtgggtggactttgccggcagaccccagataccatcctacaagctg
gtgtctcagcgctgccaggacatctctctgggggactactctctgctctggaaggcccac
aagaaactcacccgctcagccttgctgctgggcacccgcagctccatggagccctgggtg
gaccagctgacccaggagttctgcgagcgcatgagagtccaggccggtgcccccgtgacc
atccagaaggaattctgcagcatcatctgttacctcacttttggagacaaggaggacacc
ttagtatatgccattcacgactatgttcaggacttgatgaagacctgggaccactggtcc
atccagattttggacatggttccttttctcaggttcttccccaaccctgggctctggagg
ctgaagcaggccatagagaacagggaccacatggtggagaagcagctgacacgccacaag
gagagcatggtggctggccagtggagggatatgacggactacatgctccagggggtaggg
aggcaaagagtagaagagggccctggacagctcctggaaggacacgtgcacatgtctgtg
gtggaccttttcatcgggggcactgaaaccacggcgagcaccctctcctgggctgtggcg
ttcctacttcaccaccccaaggcatgccctggaggaggcaaagggatccttcctggcagc
ctggccagggtggcgggaacctag

DBGET integrated database retrieval system