KEGG   Bubalus bubalis (water buffalo): 102404192Help
Entry
102404192         CDS       T05912                                 

Definition
(RefSeq) apolipoprotein C-III
  KO
K08759  apolipoprotein C-III
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub03320  PPAR signaling pathway
bbub04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102404192
  09154 Digestive system
   04979 Cholesterol metabolism
    102404192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apo-CIII ApoC-I ATP-grasp_6 PDEase_I_N ApoA-II DUF2547
Motif
Other DBs
NCBI-GeneID: 102404192
NCBI-ProteinID: XP_025122636
LinkDB All DBs
Position
16
AA seq 96 aa AA seqDB search
MQPRLLLLAAFLALLVLPEATKAEEGSLLDKMQGYVKEATKTAKDALSSVQESQVAQQAR
DWMTESFSSLKDYWSSFKGKFTDFWESASSPTQSPP
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccggctgctccttcttgctgccttcctggcgctcctggtcttgcctgaagct
accaaggctgaggagggatcccttctggacaagatgcagggctatgtgaaggaggccacc
aagaccgccaaggatgccctgagcagcgttcaggagtcccaggtggcccagcaggccaga
gactggatgactgagagcttcagctccctgaaagactactggagctcgttcaagggcaag
ttcacggacttctgggaatctgcctccagtcccacacagtctccaccctga

KEGG   Bubalus bubalis (water buffalo): 112577643Help
Entry
112577643         CDS       T05912                                 

Gene name
APOC3
Definition
(RefSeq) apolipoprotein C-III
  KO
K08759  apolipoprotein C-III
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub03320  PPAR signaling pathway
bbub04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    112577643 (APOC3)
  09154 Digestive system
   04979 Cholesterol metabolism
    112577643 (APOC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apo-CIII ApoC-I CAGE1 PEP-utilisers_N DUF624
Motif
Other DBs
NCBI-GeneID: 112577643
NCBI-ProteinID: XP_025122637
LinkDB All DBs
Position
16
AA seq 79 aa AA seqDB search
MRNQGAMQPRLLLVAAFLALLVLPEATKAEEGSLLDKMKGYVKEATTTAKDVVQKTRDWM
TESFSSLKDYWSSFKSKFQ
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaccaaggtgccatgcagccccggctgctccttgtggctgccttcctggcgctc
ctggtcttgcctgaagctaccaaggccgaggagggatcccttctggacaaaatgaagggc
tatgtgaaggaggccaccacaactgccaaggatgtggttcagaagaccagagactggatg
actgagagcttcagctccctgaaagactactggagctcgttcaaaagcaagttccagtga

DBGET integrated database retrieval system