KEGG   Bubalus bubalis (water buffalo): 102404388
Entry
102404388         CDS       T05912                                 

Gene name
GPX4
Definition
(RefSeq) phospholipid hydroperoxide glutathione peroxidase isoform X1
  KO
K05361  phospholipid-hydroperoxide glutathione peroxidase [EC:1.11.1.12]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub01100  Metabolic pathways
bbub04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102404388 (GPX4)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    102404388 (GPX4)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.12  phospholipid-hydroperoxide glutathione peroxidase
     102404388 (GPX4)
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 102404388
NCBI-ProteinID: XP_006050558
LinkDB
Position
9
AA seq 240 aa
MGRAAACSPGRRGQRRRLPAGRRRRAPRRRRARICRRRRARPRRRRPAPESPGLAGPPAG
ESGCATESQDPCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGHVCIVTNVASQUGKTD
VNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNAEIKEFAAGYNVKFDLFSKICVNG
DDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPCYL
NT seq 723 nt   +upstreamnt  +downstreamnt
atgggccgcgcagccgcctgctccccgggtcgtcgcgggcagcggcgccgcttgccggcc
gggcgacggcgccgagcccctcgaaggaggagggctcggatatgccgtcgcaggagggcg
cgcccccggcggaggaggccagctcctgagagccctgggctggcgggacccccggccggg
gagagcggctgcgccaccgaatcccaagacccgtgcgcgtcccgcgacgactggcgctgt
gctcgctccatgcacgaattttcagccaaggacatcgacgggcacatggttaacctggac
aagtaccggggccacgtgtgcatcgtcaccaatgtggcctcgcaatgaggcaaaactgac
gtaaactacactcagctggtcgacctgcacgcccgatacgccgagtgtggtttacggatc
ctggccttcccttgcaaccagtttgggaggcaggagccagggagtaatgcagagatcaaa
gagttcgccgctggctataacgtcaaattcgatttgttcagcaagatctgtgtaaatggg
gacgacgcccaccctctgtggaaatggatgaaagtccagcccaaggggagaggcatgctg
ggaaacgccatcaaatggaacttcaccaagttcctcattgacaagaacggctgtgtggtg
aagcggtatggtcctatggaagagcccctggtgatagagaaggacctgccgtgctacctc
tag

DBGET integrated database retrieval system