KEGG   Bubalus bubalis (water buffalo): 102404535
Entry
102404535         CDS       T05912                                 

Gene name
FASLG
Definition
(RefSeq) LOW QUALITY PROTEIN: tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01524  Platinum drug resistance
bbub04010  MAPK signaling pathway
bbub04014  Ras signaling pathway
bbub04060  Cytokine-cytokine receptor interaction
bbub04068  FoxO signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04210  Apoptosis
bbub04217  Necroptosis
bbub04650  Natural killer cell mediated cytotoxicity
bbub04722  Neurotrophin signaling pathway
bbub04932  Non-alcoholic fatty liver disease
bbub04940  Type I diabetes mellitus
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05142  Chagas disease
bbub05143  African trypanosomiasis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05200  Pathways in cancer
bbub05205  Proteoglycans in cancer
bbub05320  Autoimmune thyroid disease
bbub05330  Allograft rejection
bbub05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102404535 (FASLG)
   04014 Ras signaling pathway
    102404535 (FASLG)
   04068 FoxO signaling pathway
    102404535 (FASLG)
   04151 PI3K-Akt signaling pathway
    102404535 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102404535 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102404535 (FASLG)
   04217 Necroptosis
    102404535 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102404535 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102404535 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102404535 (FASLG)
   05205 Proteoglycans in cancer
    102404535 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102404535 (FASLG)
   05330 Allograft rejection
    102404535 (FASLG)
   05332 Graft-versus-host disease
    102404535 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    102404535 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102404535 (FASLG)
   04932 Non-alcoholic fatty liver disease
    102404535 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102404535 (FASLG)
   05161 Hepatitis B
    102404535 (FASLG)
   05160 Hepatitis C
    102404535 (FASLG)
   05164 Influenza A
    102404535 (FASLG)
   05162 Measles
    102404535 (FASLG)
   05168 Herpes simplex virus 1 infection
    102404535 (FASLG)
   05163 Human cytomegalovirus infection
    102404535 (FASLG)
   05165 Human papillomavirus infection
    102404535 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102404535 (FASLG)
   05143 African trypanosomiasis
    102404535 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102404535 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102404535 (FASLG)
   04052 Cytokines and growth factors [BR:bbub04052]
    102404535 (FASLG)
   04090 CD molecules [BR:bbub04090]
    102404535 (FASLG)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102404535 (FASLG)
Cytokines and growth factors [BR:bbub04052]
 Cytokines
  Tumor necrosis fators
   102404535 (FASLG)
CD molecules [BR:bbub04090]
 Proteins
  102404535 (FASLG)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 102404535
NCBI-ProteinID: XP_006063106
LinkDB
Position
5
AA seq 278 aa
MQQPLNYPYPPIFWVDSSASSPWASPGSVFPCPSSVPGRPGQRRPPPPPPPTLPPPXPPL
PPLPPPPLKKRRDHNTGLCLLVMFFMVLVALVGLGLGIFQLFHLQKELAELRESTSQRHT
ASSLEKQIGHPSPPSEKKELKKAAHLTGKLNSRSIPLEWEDTYGIALVSGVKYKKGSLVI
NETGLYFVYSKVYFRGQSCNNQPLSHKVYSRNFRYPQDMVLMEGKMMNYCTSGKMWARSS
YLGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL
NT seq 837 nt   +upstreamnt  +downstreamnt
atgcagcagcccttgaattacccataccccccaatcttctgggtggacagcagtgccagc
tccccgtgggcctctccaggatcagtcttcccctgtccgtcctcagtgccgggaaggccg
gggcaaaggaggccaccaccaccgccacccccaacactaccgccacctnngccacccctg
cctccactaccaccaccacctctgaagaagaggagggaccacaacacaggcctgtgtctc
cttgtgatgtttttcatggttctggtggccctggttggattggggctggggatatttcag
ctcttccatctacagaaggagttggctgaactcagagagtccactagccaaaggcataca
gcatcatctttggagaagcaaataggtcaccccagtccaccctctgagaaaaaggaactg
aaaaaagcggctcatttaacaggcaagctcaactcaagatccatccctttggaatgggaa
gacacctatggaattgccctggtctctggggtgaagtacaagaagggcagccttgtgatc
aatgaaactgggctgtattttgtgtattccaaagtgtacttccggggtcagtcctgcaac
aaccagcccctgagccacaaggtctactccaggaactttaggtacccccaggacatggtg
ctgatggaggggaagatgatgaactactgcacttctggcaagatgtgggcccgcagcagc
tacctgggggctgtattcaatctcaccagtgctgaccatttatatgtcaatgtatctgaa
ctctctctggtcagttttgaggaatctaagacattttttggcttatataaactctaa

DBGET integrated database retrieval system