KEGG   Bubalus bubalis (water buffalo): 102405285Help
Entry
102405285         CDS       T05912                                 

Gene name
JAK1
Definition
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub04151  PI3K-Akt signaling pathway
bbub04217  Necroptosis
bbub04380  Osteoclast differentiation
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04621  NOD-like receptor signaling pathway
bbub04630  Jak-STAT signaling pathway
bbub04658  Th1 and Th2 cell differentiation
bbub04659  Th17 cell differentiation
bbub05140  Leishmaniasis
bbub05145  Toxoplasmosis
bbub05152  Tuberculosis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05169  Epstein-Barr virus infection
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05212  Pancreatic cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    102405285 (JAK1)
   04151 PI3K-Akt signaling pathway
    102405285 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102405285 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102405285 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102405285 (JAK1)
   04658 Th1 and Th2 cell differentiation
    102405285 (JAK1)
   04659 Th17 cell differentiation
    102405285 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102405285 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102405285 (JAK1)
   05203 Viral carcinogenesis
    102405285 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102405285 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102405285 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102405285 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102405285 (JAK1)
   05162 Measles
    102405285 (JAK1)
   05164 Influenza A
    102405285 (JAK1)
   05161 Hepatitis B
    102405285 (JAK1)
   05160 Hepatitis C
    102405285 (JAK1)
   05168 Herpes simplex virus 1 infection
    102405285 (JAK1)
   05163 Human cytomegalovirus infection
    102405285 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102405285 (JAK1)
   05169 Epstein-Barr virus infection
    102405285 (JAK1)
   05165 Human papillomavirus infection
    102405285 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102405285 (JAK1)
   05140 Leishmaniasis
    102405285 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102405285 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102405285 (JAK1)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102405285 (JAK1)
Protein kinases [BR:bbub01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102405285 (JAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2 FERM_M
Motif
Other DBs
NCBI-GeneID: 102405285
NCBI-ProteinID: XP_006058982
LinkDB All DBs
Position
6
AA seq 1158 aa AA seqDB search
MQYLNIKEDCSAMAFCAKMRSSKKAEMNLEAPEPGVEVLFYLSDREPLRLGGGEYTAEEL
CIRAAQECCISPLCHNLFALYDENTKLWYAPNRTITVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMIKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
RFHPNDSGNVVCYEVMVTGNLGIQWRQKPHIVPVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEVLGIQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLR
RCCQPKPREISNLLVATKKAQEWQPVYTMSQLSFDRILKKDITQGEHLGRGTRTHIYSGT
LTDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLTVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKKPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSE
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQHMRKCWEFQPSNRTT
FQNLIEGFEALLRSMSNI
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcagtgccatggctttctgtgctaaaatgagg
agctccaagaaggcggagatgaatctggaggcccctgagccgggggtggaggtgctcttc
tacctgtcggatagggagcctctccggctgggcggtggagagtacacggcggaggagctg
tgcatccgggcggcgcaggagtgctgtatctctcctctgtgtcacaacctctttgccctg
tatgacgagaacaccaagctctggtatgctccgaatcgcaccatcaccgtcgacgacaaa
acgtcgctccggctgcactaccggatgaggttctatttcaccaactggcatgggaccaat
gacaacgaacaatcagtatggcgacattctccaaagaagcagaaaaacggctatgagaaa
aaaaaagttccagatgcaacacctctccttgacgccagctcactggagtatctgtttgct
cagggacagtatgatttggtcaaatgcctggctcccattcgagaccccaagacggagcag
gatgggcacgacattgagaacgagtgtcttgggatggctgtgctggccatctcccactac
gccatgataaagaagatgcaattgccagaactccccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggattttctaaaggagtttaacaacaagaccatttgtgacagcagc
gtgtccacgcacgatctgaaggtgaaatacctggctaccctggaaactttgacaaaacat
tatggtgctgaaatatttgagacttccatgctactgatttcatcagaaaatgagatgaat
cggttccatcccaatgatagtggaaatgttgtctgctatgaagtgatggtgactggaaat
cttggaatccagtggagacagaaaccacatattgttcctgttgaaaaggaaaaaaacaaa
ctgaaacggaaaaaactggaaaataaacacaagaaggatgaggaaaaaaacaaaatccga
gaagagtggaacaatttttcttacttccctgagatcactcacattgtaatcaaggagtct
gtggtcagcattaataagcaggacaacaaaaaaatggaactgaagctctcttcccacgag
gaggccttgtccttcgtgtccctggtggatggctacttccggctcacagcagatgcccat
cactacctctgcactgacgtggctcccccattgatagtccacaacatacagaatggctgt
catggtccaatctgcacggagtatgccatcaataagctgcggcaggaggggagcgaggag
gggatgtacgtgctgcggtggagctgcactgactttgacaacatcctcatgaccgtcacc
tgcttcgaaaagtctgaggtgctgggtatccagaaacagttcaagaactttcagatcgag
gtgcagaagggccgctacagcctgcatggctcagaccgcagcttcccgagccttggggac
ctcatgagccacctaaagaagcagatcctgcgcacggacaacatcagcttcgtgctgagg
cgctgctgccagcccaagccccgagaaatctccaatctgctggtggccaccaagaaagcc
caggagtggcagcctgtctacaccatgagccagctgagtttcgatcgaatcctcaagaaa
gatattacgcaaggcgagcaccttgggagaggcacgcggacacacatctactctgggacc
ctcacggattacaaggatgacgaagggacttctgaagagaagaggataaaagtcatcctg
aaggtcttagaccccagccacagggacatttctctggccttctttgaggcagccagcatg
atgaggcaggtctcccacaaacacatcgtgtacctctatggggtttgtgtccgagacgtg
gagaatatcatggtggaagagtttgtggaggggggacccctggatctcttcatgcatcgg
aaaagtgacgtcctcaccacaccctggaagtttaaagttgccaaacagctggccagcgcc
ctgagttacttggaggataaagacctggtccatggaaatgtgtgcactaaaaacctcctt
ctggcccgcgagggcatcgacagtgagtgcggccccttcatcaagctcagtgaccctggc
atccccatcactgtgctctccaggcaagagtgcatagagcgaatcccctggatcgctccc
gagtgtgttgaagactccaagaatctgactgtggctgctgacaagtggagctttggaacc
acactctgggaaatctgctacaatggcgagatccccttgaaagacaagacactgattgag
aaagagagattctatgaaagccggtgcaggccagtgaccccgtcttgtaaggagctagct
gacctgatgacccgctgcatgaactacgaccccaaccagagacccttcttccgggccatc
atgagagacatcaataagctggaggagcagaatccagacattgtatcagaaaaaaagcca
acaactgaagtggatcccacacattttgaaaagcggttcttaaagaggatccgtgacttg
ggagagggccactttgggaaggtagagctctgcaggtatgaccctgagggggacaataca
ggggagcaagtggctgtcaaatccctgaagcccgagagtggagggaaccacatcgctgat
ctgaagaaggagattgaaatcttaagaaatctttatcatgagaacattgtgaagtataaa
ggcatctgcacagaagacggtggaaatggtattaagctcatcatggagtttctgccttca
gggagccttaaggaatatcttccaaagaataagaacaaaattaacctcaaacagcaatta
aaatatgccgttcagatttgtaaggggatggactatctgggttctcggcagtacgttcac
cgggacttggcagcaaggaacgtcctcgtggagagtgagcaccaggtgaaaatcggggac
ttcggcctcaccaaagccatcgaaaccgataaggagtactacacagtcaaggacgaccgg
gacagccccgtgttttggtatgctccagaatgtttaattcagtgtaagttctatatcgcc
tctgatgtctggtctttcggagtgactttgcacgagctgctcacttactgtgattcagag
tccagtcccatggccttgttcctgaaaatgataggcccaactcatggtcagatgacggta
acaagactcgtgaacacattaaaagaaggaaaacgcttgccgtgtccaccgaactgtcca
gatgaggtttatcaacatatgcgaaagtgttgggaatttcaaccatctaatcggacaacc
tttcagaaccttattgaaggatttgaagcacttctaagaagcatgagtaacatttaa

DBGET integrated database retrieval system