KEGG   Bubalus bubalis (water buffalo): 102405498Help
Entry
102405498         CDS       T05912                                 

Gene name
APOA1
Definition
(RefSeq) apolipoprotein A-I isoform X1
  KO
K08757  apolipoprotein A-I
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub03320  PPAR signaling pathway
bbub04975  Fat digestion and absorption
bbub04977  Vitamin digestion and absorption
bbub04979  Cholesterol metabolism
bbub05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102405498 (APOA1)
  09154 Digestive system
   04975 Fat digestion and absorption
    102405498 (APOA1)
   04979 Cholesterol metabolism
    102405498 (APOA1)
   04977 Vitamin digestion and absorption
    102405498 (APOA1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    102405498 (APOA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102405498 (APOA1)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102405498 (APOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein YtxH ApoLp-III DUF883 Exonuc_VII_L Baculo_PEP_C DHC_N1 DUF948 DUF4455 KMP11 ApoO DUF445 Gp-FAR-1 ApoC-I OmpH WXG100 MobL DUF1640 Prominin Gon7 HIP1_clath_bdg SF-assemblin PIN_8 Borrelia_REV AbiH DUF4407 Phasin TPD52 FAM184 Gp58 TipAS FAA_hydro_N_2 DUF2884 HD_4 Laminin_II FlgN Muted BshC Mst1_SARAH Use1 Nup54 DUF3106
Motif
Other DBs
NCBI-GeneID: 102405498
NCBI-ProteinID: XP_025122634
LinkDB All DBs
Position
16
AA seq 265 aa AA seqDB search
MKAVVLTLAVLFLTGSQARHFWQQDDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASA
LGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKV
QPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVE
TLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPALEDLRQGL
LPMLESLKVSILAAIDEASKKLNAQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtggtgctgaccttggctgtgctcttcctgacgggaagccaggctcggcat
ttctggcagcaagatgacccccagtcatcctgggatcgggtgaaggattttgccaccgtg
tatgtggaagcaatcaaggatagtggcagagactatgtggcccaattcgaagcctccgct
ttgggaaaacagctcaacctgaaactcctggacaactgggacaccctggccagcacgttg
tccaaagtgcgggaacagctgggcccggtgacccaggagttctgggacaacctggaaaag
gagacagcgtcgctgaggcaggagatgcacaaggacctggaggaggtgaagcagaaggtg
cagccctacctggacgagttccagaagaagtggcacgaggaggtggagatctaccgccag
aaggtggcgccgctgggcgaggagtttcgcgagggcgcgcgccagaaggtgcaggagctg
caggacaagctgagcccgctggcccaggagctccgcgaccgcgcgcgcgcccacgtggag
acgctgcggcagcagctggcgccctacagcgacgacctgcgccagcggctgaccgcgcgc
ctggaggcgctcaaggagggcggcggcagcctggccgagtaccacgccaaggccagcgag
cagctgaaggcgctgggcgagaaggccaagccggcgctggaggacctccgccagggcctg
ctgcccatgctggagagcctcaaggtcagcatcctggccgccatcgacgaggcctccaag
aagctgaacgcccagtga

DBGET integrated database retrieval system