KEGG   Bubalus bubalis (water buffalo): 102405840Help
Entry
102405840         CDS       T05912                                 

Gene name
APOA5
Definition
(RefSeq) apolipoprotein A-V
  KO
K09025  apolipoprotein A-V
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102405840 (APOA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bbub00536]
    102405840 (APOA5)
Glycosaminoglycan binding proteins [BR:bbub00536]
 Heparan sulfate / Haparin
  Others
   102405840 (APOA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein ApoLp-III Exonuc_VII_L BcrAD_BadFG ZnuA CitG
Motif
Other DBs
NCBI-GeneID: 102405840
NCBI-ProteinID: XP_006056945
LinkDB All DBs
Position
16
AA seq 368 aa AA seqDB search
MASVAAVLTWALALLSLLSPTEARRGFWDYFSQSSGDKGKVEQQQKLAREPPSLKERLEP
DLSDMDKFLEKLGPLNGQGRELPRLPRDPVGMWQQLQEELEEVRARLEPYMAEVHERVGW
NLEGLRRQLQPYTVELMEQVALRVHELQEQLRVVGEGTKAQLLGGVDEARGLLQELQNRV
AHHTGRVKALFHPYAERLVSGIGHHVQELHRSVAPHAIVSPARLSRCVQMLSRKLTLKAK
ALHERIQQNLDQLREELSAFAGARGDDAEEAAQPDPQVLSQEVRQRLQAFRQDTFRQIAA
FTHAIDRETEQVQQQLAPPPPGHSAFAPEFLQADRGKARGELQARFDDLWEDINYSLRDH
SPGHRGEP
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgtggctgcagttctgacctgggctctggccctcctctcactgctttcaccc
acggaggcacggagaggcttctgggactacttcagccagagcagcggggacaaaggcaag
gtggagcagcagcagaagctggcaagagagcccccgagcctgaaagaaagacttgagcca
gacctcagcgatatggacaagttcctggaaaagctgggccctctgaacgggcaggggagg
gagcttcccaggctcccacgcgacccggtgggcatgtggcagcagctgcaggaggagctg
gaggaggtgcgggcgcgtctggagccctacatggcggaggtgcacgagcgcgtgggctgg
aacctggaggggctgcgacggcagctgcagccctacacggtggagctgatggagcaggtg
gccctgcgcgtgcacgagctgcaggagcagttgcgcgtggtcggagagggcaccaaggcc
cagttgctggggggcgtggacgaggcgcggggcctgctgcaggagctgcagaaccgcgtg
gcacaccacaccggccgcgtcaaggcgctcttccacccctacgccgagcgcctggtgtcc
ggcattgggcaccacgtgcaggagctgcaccgcagcgtggcgccgcacgccatagtcagc
cccgcgcgcctcagccgctgcgtgcagatgctctcccgcaagctcacgctcaaggccaag
gcgctgcacgagcgcatccagcagaacctagaccagttgcgcgaggagctcagcgccttt
gctggcgcccgcggtgacgatgcggaggaagcggctcaaccggatccccaggtgctgtcc
caggaggtgcgccaacgactccaggctttccgccaggacaccttccggcagattgccgcc
ttcactcacgccattgaccgagagactgagcaggtccagcagcagctggcgccgcctccg
ccaggccacagtgcctttgcccctgagttcctccaagccgacagaggcaaggcccggggc
gagctgcaggcccgcttcgacgacctgtgggaagacatcaactacagccttcgcgaccat
agtccgggccatcggggagagccctga

DBGET integrated database retrieval system