KEGG   Bubalus bubalis (water buffalo): 102406138
Entry
102406138         CDS       T05912                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01522  Endocrine resistance
bbub04012  ErbB signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04151  PI3K-Akt signaling pathway
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04934  Cushing syndrome
bbub05162  Measles
bbub05165  Human papillomavirus infection
bbub05169  Epstein-Barr virus infection
bbub05200  Pathways in cancer
bbub05202  Transcriptional misregulation in cancer
bbub05203  Viral carcinogenesis
bbub05206  MicroRNAs in cancer
bbub05215  Prostate cancer
bbub05220  Chronic myeloid leukemia
bbub05222  Small cell lung cancer
bbub05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102406138 (CDKN1B)
   04066 HIF-1 signaling pathway
    102406138 (CDKN1B)
   04068 FoxO signaling pathway
    102406138 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    102406138 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102406138 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102406138 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    102406138 (CDKN1B)
   05206 MicroRNAs in cancer
    102406138 (CDKN1B)
   05203 Viral carcinogenesis
    102406138 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    102406138 (CDKN1B)
   05220 Chronic myeloid leukemia
    102406138 (CDKN1B)
   05215 Prostate cancer
    102406138 (CDKN1B)
   05222 Small cell lung cancer
    102406138 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102406138 (CDKN1B)
   04934 Cushing syndrome
    102406138 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    102406138 (CDKN1B)
   05169 Epstein-Barr virus infection
    102406138 (CDKN1B)
   05165 Human papillomavirus infection
    102406138 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102406138 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102406138
NCBI-ProteinID: XP_006075723
LinkDB
Position
4
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFKNHKPLEGKYEWQEVEKGSLPEFYHRPPRPPKGACKVPAQEGQDASGARPAVPLLG
SQANPEDTHLVDQKTDAQDSQTGLAEQCPGIRKRPAADDSSPQNKRANRTDENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctggagcggatggacgccagacag
gcggagtaccccaagccttcggcttgcagaaacctctttggcccggtcaatcacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggccagccagcgcaagtgg
aattttgattttaagaatcacaagcccctggagggcaagtacgagtggcaggaggtagaa
aagggcagcctgcccgagttctaccacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggaaggccaggatgccagcggggcccgcccggcggtccctttacttggg
tctcaggcaaacccagaggacacgcatttggtcgatcagaagactgatgcccaggacagc
cagaccgggttagcggagcagtgccctgggataaggaagcgacctgccgcagatgattcc
tctcctcaaaacaaaagagccaacagaacagatgaaaatgtttcagacggttcccccaac
gccggttcagtggagcagacgcccaagaagcctggcctcagaaggcgtcagacgtaa

DBGET integrated database retrieval system