KEGG   Bubalus bubalis (water buffalo): 102406217
Entry
102406217         CDS       T05912                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04915  Estrogen signaling pathway
bbub05200  Pathways in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05223  Non-small cell lung cancer
bbub05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102406217 (TGFA)
   04012 ErbB signaling pathway
    102406217 (TGFA)
   04014 Ras signaling pathway
    102406217 (TGFA)
   04151 PI3K-Akt signaling pathway
    102406217 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102406217 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102406217 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102406217 (TGFA)
   05212 Pancreatic cancer
    102406217 (TGFA)
   05225 Hepatocellular carcinoma
    102406217 (TGFA)
   05214 Glioma
    102406217 (TGFA)
   05211 Renal cell carcinoma
    102406217 (TGFA)
   05215 Prostate cancer
    102406217 (TGFA)
   05223 Non-small cell lung cancer
    102406217 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102406217 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 102406217
NCBI-ProteinID: XP_006049306
LinkDB
Position
12
AA seq 160 aa
MVTSAGQLALFALGIFLAVCQALENSTSALSADPPVAAAVVSHFNDCPDSHSQFCFHGTC
RFLVQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCEVRKHCEWCRALICRHEKSSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcacctcggctggacagctcgccctcttcgcgctgggtattttcttggccgtgtgc
caggccctggagaacagcacatccgccctgagtgcagacccgcccgtggctgcagctgtg
gtgtcccattttaatgactgcccagattcccacagtcagttctgcttccatggaacctgc
aggtttttggtgcaggaggagaagccagcgtgtgtctgccactctgggtacgtcggtgca
cgctgtgaacacgcagacctcctggccgtggtggctgccagccagaagaagcaggccatc
accgccttggtggtggtctccatcgtggccctggctgtcctcatcatcacatgtgtgctg
atacactgctgcgaggtccgaaaacactgtgagtggtgccgggcgctcatctgccggcat
gagaagtccagcgccctcctgaagggaaggactgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system