KEGG   Bubalus bubalis (water buffalo): 102407124
Entry
102407124         CDS       T05912                                 

Definition
(RefSeq) alcohol dehydrogenase class-3
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00010  Glycolysis / Gluconeogenesis
bbub00071  Fatty acid degradation
bbub00350  Tyrosine metabolism
bbub00830  Retinol metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub01100  Metabolic pathways
bbub01200  Carbon metabolism
bbub05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102407124
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102407124
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102407124
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102407124
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102407124
   00982 Drug metabolism - cytochrome P450
    102407124
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102407124
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     102407124
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     102407124
SSDB
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 102407124
NCBI-ProteinID: XP_006059259
LinkDB
Position
7
AA seq 374 aa
MANQVIKCKAAVAWEAGKPLSIEEVEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGN
YPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGK
GLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGY
GAALNAAKVEPGSTCAVFGLGGVGLAVIMGCKVAGATRIIGVDINKDKFARAKEFGASEC
INPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGISVVVGVAASGEE
IATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHSLPFDQINEAFD
LMHAGKSIRTVVKL
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcgaaccaggttatcaagtgcaaggctgcagttgcctgggaggctgggaagcctctt
tctatagaggaggtagaggtggcacccccaaaggctcatgaagttcgaattaagattatt
gccactgcagtttgccacactgatgcctatacactgagtggggctgatcctgaagggaat
tatccagtgatcttgggacacgaaggtgctggaattgtggagagtgttggtgaaggagtt
actaagctgaaggcaggtgatactgtcatcccactttacatcccccagtgtggagaatgc
aaattttgtctgaatcctaaaacaaacctttgccagaagataagagtcactcaaggaaaa
ggattaatgccagatggcactagcagatttacttgtaaaggaaagacaattttacattac
atgggtaccagcacattttctgaatacacagttgtggctgacatttctgttgctaaaatt
gatcctttagcacctttggacaaagtttgccttctgggttgtggcatttcaactggctat
ggtgctgctttgaatgctgccaaggtggagcctggctctacttgtgctgtctttggcctg
ggaggagttggattggcagttatcatgggctgtaaggtggctggtgcaacccggatcatt
ggtgtggacatcaataaggataaattcgcaagagccaaggagttcggggcctctgagtgt
attaacccccaggacttcagtaaaccgatccaggaagtgctcattgagatgactgacggg
ggagttgactattcctttgagtgtattggtaatgtgaaagtcatgagagcagcactggag
gcctgccacaaaggctggggcatcagtgtggtagtgggagtagctgcctctggtgaagaa
atcgccactcgtccgttccagctagtcacgggccgcacgtggaaaggcactgcctttgga
ggatggaagagtgtagaaagtgtcccaaagttggtgtctgaatatatgtccaaaaagata
aaagttgatgagtttgtgactcacagtctgccttttgaccaaattaatgaagcctttgat
ctgatgcatgccggaaagagcatccgaacggttgtaaagctttaa

KEGG   Bubalus bubalis (water buffalo): 102407428
Entry
102407428         CDS       T05912                                 

Gene name
ADH4
Definition
(RefSeq) alcohol dehydrogenase 4
  KO
K13980  alcohol dehydrogenase 4 [EC:1.1.1.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00010  Glycolysis / Gluconeogenesis
bbub00071  Fatty acid degradation
bbub00350  Tyrosine metabolism
bbub00830  Retinol metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub01100  Metabolic pathways
bbub05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102407428 (ADH4)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102407428 (ADH4)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102407428 (ADH4)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102407428 (ADH4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102407428 (ADH4)
   00982 Drug metabolism - cytochrome P450
    102407428 (ADH4)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102407428 (ADH4)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     102407428 (ADH4)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N ThiF TrkA_N
Other DBs
NCBI-GeneID: 102407428
NCBI-ProteinID: XP_006059260
LinkDB
Position
7
AA seq 380 aa
MGTKGKIIKCKAAIAWEANKPLSIEEVEVAPPKDHEVRIQIIATALCHSDAHILHPQFEG
AFFPVILGHEAAGIVESIGPGVTNFKPGDKVIPLYAPQCGKCKFCLSPRTNFCGKLKHFK
NPMGDQKLMEDGTSRFTCKGKPIYRFMGTSTFSHYTVVSDVNLAKLEDDANLERVCLLGC
AFSTGYGAVINNAKVTPGSTCAIFGLGGVGLSAVMGCKASGASRIIVVDINSEKFTKAKA
LGATDCLNPKDLDKPIQEVIVEMTNGGVDFAFECVGGAKIMRAALDSVTVGWGVCTIIGV
NVGDNGLNVSAMELLMGRTLTGTSFGGWKGVTSVPKLAADYKNKKLDLDALVTHTLPFDK
VNEAFDLMYQGKSIRTVLLF
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgggcaccaagggaaaaattattaaatgcaaagcagctatcgcctgggaagcaaacaag
cccctcagcattgaagaggttgaggtagctccccccaaggatcatgaagttcgaatccag
ataattgccactgccctgtgccattctgatgcccatattctccatcctcaatttgagggg
gcgtttttcccagtgattcttggccatgaggctgcaggaattgtggaaagtattgggcca
ggagtgaccaacttcaaaccaggtgacaaagtaattccactctacgcacctcagtgtgga
aaatgcaagttctgtctaagtccacgcacaaatttttgtggaaaactcaagcattttaaa
aatcctatgggtgatcaaaaattaatggaagatggaactagcaggtttacctgcaaagga
aaaccaatttaccgtttcatggggaccagtaccttcagtcactacactgtggtctcagat
gtcaaccttgccaaactagaggacgatgccaatttagagagagtttgtctgcttggatgt
gcattttcaactggctatggagctgtcatcaacaatgccaaggtcacacctggttctacc
tgtgccatctttggcctaggaggtgttggtctctctgctgtaatgggttgtaaagcatca
ggagcttcccgaatcatagttgttgacatcaatagtgagaagtttacaaaagccaaagcc
cttggagccactgactgcctcaatcctaaagacctagacaaacccattcaagaggtcatt
gttgaaatgaccaatggaggtgtggactttgcctttgagtgtgtaggaggagctaaaatc
atgagagctgccctggacagtgtaacagtaggctggggagtatgcactatcattggagta
aacgttggtgacaatggcttgaatgtgtctgcaatggagctactaatgggccgtactcta
actggaacaagctttggtggttggaaaggtgtcacttctgttccaaagctggctgctgac
tacaagaataagaaattggatttggatgcattggtgacccataccctaccttttgacaaa
gtcaatgaggcatttgatctaatgtaccaaggaaaaagcattcggacagtcctgctcttt
tga

KEGG   Bubalus bubalis (water buffalo): 102407762
Entry
102407762         CDS       T05912                                 

Definition
(RefSeq) alcohol dehydrogenase 6 isoform X1
  KO
K13952  alcohol dehydrogenase 6 [EC:1.1.1.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00010  Glycolysis / Gluconeogenesis
bbub00071  Fatty acid degradation
bbub00350  Tyrosine metabolism
bbub00830  Retinol metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub01100  Metabolic pathways
bbub05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102407762
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102407762
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102407762
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102407762
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102407762
   00982 Drug metabolism - cytochrome P450
    102407762
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102407762
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     102407762
SSDB
Motif
Pfam: ADH_zinc_N ADH_N UDPG_MGDP_dh_N ADH_zinc_N_2 TrkA_N 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 102407762
NCBI-ProteinID: XP_006059261
LinkDB
Position
7
AA seq 375 aa
MSTTGKVIRCKAAIVWKPGGSFSIEEVEVAPPKAKEVRIKMVATALCGTEMKMLKDKNLQ
HQHYPIIMGHEGAGIVESVGEGVSTVKAGDKVITLFLPQCGECTSCLNSADNFCIKLKQA
ETYLMSDGTSRFTCKGKPVYHFGNTSTFSEYTVMDEISVAKIDAAAPLEKVFLVSCGFST
GYGGAINTAKVTPGSTCAVFGLGGVGLSVIMGCKAAGATRIIAVDINKDKFEKAKEVGAT
ECINPQDYEKPIQEVLFDLTGDGVDFSFEVIGNPETVAAALASCHESHGVCVIIGLIIGV
QLNISGHLFFSGRSLKGSIYGGWKGRDGASKLVSDYMAKKINLDALITHSLNLDKINEAV
ELMKTGKCVRCVLLL
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgagtactacagggaaagttatcaggtgcaaagcagccatagtctggaagcctggtgga
tcattttccattgaggaggtagaagtggctccaccaaaggcaaaagaagttcgcataaag
atggtggccacggcgctctgtgggaccgagatgaaaatgttgaaggataaaaatcttcag
caccaacactaccctatcattatgggccatgaaggagctggaatagtcgagagtgtggga
gaaggagtgagcacagtgaaagcaggagataaagtcatcacactctttctaccacagtgt
ggagaatgcacctcttgccttaattctgcagacaatttttgtataaaactcaaacaggca
gaaacctacctgatgtctgatggtaccagtagatttacctgtaagggaaaaccagtatac
cactttgggaatacaagcaccttctctgaatacacagtaatggatgaaatctcagtcgcc
aagattgatgcagctgcacctctggagaaagtattcctagttagctgtggtttttctact
gggtatggtggtgcaatcaatactgccaaggtgaccccaggctccacttgtgctgtgttt
ggcctgggaggagttggcctgtctgttatcatgggctgcaaagcagctggagcaaccagg
atcattgcagtggacatcaacaaagacaaatttgagaaggcaaaggaagtgggtgccact
gagtgcatcaacccacaggactatgagaaacccatccaagaagttttatttgacctgaca
ggtgatggtgtggactttagctttgaggtcattggaaatccagaaactgtggcagctgcc
ctggcctcctgccatgagagccatggggtctgcgtgattattgggttaatcattggtgtc
caactcaacatcagtggccacttgttcttctcaggacgctctttaaagggatctatttat
ggaggctggaaaggcagagatggtgcctctaaactggtttctgattatatggcaaagaag
attaacctagatgcactaattacccattctctgaatcttgacaaaatcaacgaagcagtt
gaattaatgaaaactggaaaatgtgtccgctgtgtcctgttactttaa

KEGG   Bubalus bubalis (water buffalo): 102408659
Entry
102408659         CDS       T05912                                 

Definition
(RefSeq) alcohol dehydrogenase E chain
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00010  Glycolysis / Gluconeogenesis
bbub00071  Fatty acid degradation
bbub00350  Tyrosine metabolism
bbub00830  Retinol metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub01100  Metabolic pathways
bbub05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102408659
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102408659
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102408659
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102408659
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102408659
   00982 Drug metabolism - cytochrome P450
    102408659
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102408659
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     102408659
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 102408659
NCBI-ProteinID: XP_006059264
LinkDB
Position
7
AA seq 375 aa
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVNGSVVT
RLPVVLGHEGAGIVESVGEGVTTVRPGDKVIPLFVPQCGKCNVCKHPEANLCLKHDLNEP
QGTLSDGTCRFTCRGKPIHHFLGTSTFTQYTVVDEMSVAKIHEDSPLEKVCLIGCGFSTG
YGSAVKIAKVTQGSTCAVFGLGGVGLSVIIGCKAAGAARIIAVDINKDKFARAKQVGATE
CINPQDYEKPIEEVLKEVSGGGVDFSFEVIGRLDTMMSALLCCQEAYGVSVIVGVPPYAQ
NIPMNPMLLLTGRTWKGAVFGGFKSKESVPKLVTDFMAKKFSLDQLITHVLPLEKINEGF
DLLRSGKSVRTILTF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaataaaatgcaaagcagctgtgctgtgggagctcaagaaa
ccattttccattgaggaggtggaggttgcaccccctaaggcccatgaagttcgtattaag
atggtggccacaggaatctgtcgctcagatgaccatgtggttaatggatctgtggtcaca
cgtcttcctgtggtcttaggccatgagggagccggcattgtggagagcgttggagaaggg
gtgactacagtaagaccaggtgataaagtcatcccactctttgttccccagtgtggaaag
tgcaatgtttgtaaacacccggaagccaacctctgcctgaaacacgacctgaatgagccg
caggggacccttagtgatggtacctgcaggttcacctgcagggggaagcccatccaccac
ttcctcggcaccagcaccttcacccagtacacagtggtggatgagatgtcagtggccaag
atccatgaagactcaccgctggagaaagtctgtctcattggctgcggattttctactggt
tatgggtctgcggtcaaaattgccaaggttacccagggctccacctgtgccgtgtttggc
cttggaggagttggcctgtctgttatcataggctgcaaagcagctggagcagccaggatc
attgcagtggacatcaacaaagacaaatttgcaagggccaaacaggtgggtgccacagag
tgcatcaaccctcaggactacgagaaacccatcgaggaggtgctgaaagaagtgagtggt
ggaggtgtggatttttcatttgaagtcatcggtcggcttgacaccatgatgtctgccttg
ctgtgctgtcaagaagcatatggtgtaagcgtcattgtaggagtacctccttatgcccaa
aatatccctatgaaccccatgttgctgttgactggacgtacctggaaaggagctgtgttt
ggtggcttcaaaagtaaagaatctgtccccaaacttgtgactgatttcatggctaagaag
ttttcactggatcagttaattacccatgttttaccacttgaaaaaataaatgaaggattt
gacctgcttcgctctggaaagagtgtccgtaccatcctgacattttga

KEGG   Bubalus bubalis (water buffalo): 102408967
Entry
102408967         CDS       T05912                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: alcohol dehydrogenase class 4 mu/sigma chain
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00010  Glycolysis / Gluconeogenesis
bbub00071  Fatty acid degradation
bbub00350  Tyrosine metabolism
bbub00830  Retinol metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub01100  Metabolic pathways
bbub05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102408967
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102408967
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102408967
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102408967
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102408967
   00982 Drug metabolism - cytochrome P450
    102408967
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102408967
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     102408967
SSDB
Motif
Pfam: ADH_N ADH_zinc_N
Other DBs
NCBI-GeneID: 102408967
NCBI-ProteinID: XP_006059265
LinkDB
Position
7
AA seq 367 aa
MGTAGKVIKCKVALLWEQKKLFSIEIQVVPPKAKEVRIKVLAMGICQTDDHGXKGAIVSK
FSVIVGHEATGVVDSIGEGVTTVKPDDKVIPHFLPQCRECNACRNPDGNPCIRTDITGHG
VLADGSPRFTCKGKPVYHFLSTSTFTEYTAVDETSIAKSDDAAPPEKVCLTGCGFSTGHR
TTIKIGKVTPGSMCVVFGLGGVGLSVIMGCNSAGASRIVGADLNKDKFEKAMAVGATECI
SPKDFTKPISEVLSEMTGDTKGCSFEVIGHLETMVRALENCNMGQYGTQSILGPPSAKML
TYTQHMWKGCIFEGWKSRNYVPNLVTDFLEKKFDLDQLITHDLPFRKINERFELLNSGQS
VQTVLTF
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgggcactgctgggaaggttattaaatgtaaagtggctctgctatgggaacagaagaaa
ctcttttccattgagatacaagttgttccaccaaaggcaaaagaagtccgtattaaggtg
ttggcaatgggaatctgtcaaacagatgaccatggataaaagggagcaatagtgtctaag
ttttcagtgattgtgggacatgaagccactggggttgtagacagcattggagaaggagtc
actacagtgaaaccagatgacaaagtcatcccccactttctgcctcagtgtagagaatgc
aatgcttgtcgcaacccagatggcaacccttgtataaggacagacatcactggtcatgga
gttctggctgatggcagccccagatttacatgcaagggcaagccagtctatcacttcttg
agcaccagtacattcactgagtacacggcagtggatgaaacttccatcgctaagagtgat
gatgcagctcctcctgagaaagtctgtttaactggatgtggattttccactggacacagg
accactattaagattggcaaggtcacccctggctcaatgtgtgtggtctttggcctggga
ggagttggcctttcggtcatcatgggctgtaattcagctggtgcatccaggattgttggg
gctgacctcaacaaagacaagtttgaaaaggccatggctgtaggagccactgagtgcatc
agccccaaggacttcaccaagcccatcagtgaggtgctgtcagaaatgacaggtgacact
aagggctgcagttttgaagttattgggcatcttgaaactatggtaagagctctggagaac
tgcaatatgggacaatatgggacacagtcaattctgggtcctccatcagccaagatgctc
acttacacccaacacatgtggaagggatgcatttttgaaggttggaaaagcagaaattat
gttccaaacctagtgactgatttcctggaaaagaaatttgacctggaccaattgataaca
catgatttaccttttagaaaaatcaatgaaagatttgaactgcttaactcaggacaaagc
gttcaaactgtcctgacattttga

DBGET integrated database retrieval system