KEGG   Bubalus bubalis (water buffalo): 102407190
Entry
102407190         CDS       T05912                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04010  MAPK signaling pathway
bbub04020  Calcium signaling pathway
bbub04022  cGMP-PKG signaling pathway
bbub04024  cAMP signaling pathway
bbub04260  Cardiac muscle contraction
bbub04261  Adrenergic signaling in cardiomyocytes
bbub04270  Vascular smooth muscle contraction
bbub04713  Circadian entrainment
bbub04720  Long-term potentiation
bbub04723  Retrograde endocannabinoid signaling
bbub04724  Glutamatergic synapse
bbub04725  Cholinergic synapse
bbub04726  Serotonergic synapse
bbub04727  GABAergic synapse
bbub04728  Dopaminergic synapse
bbub04742  Taste transduction
bbub04911  Insulin secretion
bbub04912  GnRH signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04924  Renin secretion
bbub04925  Aldosterone synthesis and secretion
bbub04927  Cortisol synthesis and secretion
bbub04929  GnRH secretion
bbub04930  Type II diabetes mellitus
bbub04934  Cushing syndrome
bbub04935  Growth hormone synthesis, secretion and action
bbub05010  Alzheimer disease
bbub05020  Prion disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05031  Amphetamine addiction
bbub05410  Hypertrophic cardiomyopathy
bbub05412  Arrhythmogenic right ventricular cardiomyopathy
bbub05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102407190 (CACNA1C)
   04020 Calcium signaling pathway
    102407190 (CACNA1C)
   04024 cAMP signaling pathway
    102407190 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    102407190 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102407190 (CACNA1C)
   04929 GnRH secretion
    102407190 (CACNA1C)
   04912 GnRH signaling pathway
    102407190 (CACNA1C)
   04921 Oxytocin signaling pathway
    102407190 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    102407190 (CACNA1C)
   04924 Renin secretion
    102407190 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    102407190 (CACNA1C)
   04927 Cortisol synthesis and secretion
    102407190 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102407190 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    102407190 (CACNA1C)
   04270 Vascular smooth muscle contraction
    102407190 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    102407190 (CACNA1C)
   04727 GABAergic synapse
    102407190 (CACNA1C)
   04725 Cholinergic synapse
    102407190 (CACNA1C)
   04728 Dopaminergic synapse
    102407190 (CACNA1C)
   04726 Serotonergic synapse
    102407190 (CACNA1C)
   04720 Long-term potentiation
    102407190 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    102407190 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    102407190 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102407190 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102407190 (CACNA1C)
   05020 Prion disease
    102407190 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    102407190 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    102407190 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102407190 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102407190 (CACNA1C)
   05414 Dilated cardiomyopathy
    102407190 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102407190 (CACNA1C)
   04934 Cushing syndrome
    102407190 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bbub04040]
    102407190 (CACNA1C)
Ion channels [BR:bbub04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102407190 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 102407190
NCBI-ProteinID: XP_025138708
LinkDB
Position
4
AA seq 2167 aa
MLRAFFPHSTPGYQPLPRRRANTQAGSRGTLVHEAQLSCSYVSPGGPSYGSPRPAHANMN
ANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPKK
QGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDD
SNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAI
LEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHI
ALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTV
CKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIF
GSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPEN
EDEGLDEEKPRNMSMPTSETESVNTENVAGGDIEGESCGARLAHRISKSKFSRYWRRWNR
FCRRKCRAAVKSSIFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEM
LLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKIT
RYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDN
FPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAI
AVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVVEKQAVEETKEEKIELKSITA
DGESPPATKINMDDLQPNENEDKSSYPNQETTGEEDEEEPEMPVGPRPRPLSELHLKEKA
VPMPEASAFFIFSPSNRFRLQCHRIVNDSIFTNLILFFILLSSISLAAEDPVQHTSFRNH
ILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAI
NVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLF
KGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTV
STFEGWPELLYRSIDSHTEDKGPIYNYRVEISVFFIIYIIIIAFFMMNIFVGFVIVTFQE
QGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILL
NTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMVLKLIAFKPKHYFCDAWNTFDALIV
VGSIVDIAITEVNPAEHTQCSPFMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLW
TFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFR
CATGEAWQDIMLACMPGKKCAPESEPGNSTEGETPCGSSFAVFYFISFYMLCAFLIINLF
VAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFG
KLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKK
IWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSL
QAGLRTLHDLGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVGYYP
SDGRGAFPQTFTTQRPLHISKAGNSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNAN
NTALGRCPRPALHSGAVSTLEAHGPPLSPAIRVQEAAWRHSSQRCPSRDSPIAMLCQEES
PGDETCAMHVDENAERSSEPSLVSTEMLSYQDDENRQLTPPEEDRRDIRLSPKRGFLRSA
SLGRRASFHLECLKRQKNPGGDVSQKTVLPLHLVHHQALAVAGLSPLLQRSHPPGTLPPP
RLTPPATPGPAWPPRPVPTLRLEGAESSDKLTSSFPSIHCDPHVGEPTPCGVVGTPRRAR
PVSLTVPSPAGPQGRPFHGSASSLVEAVLISEGLGQFAQDPRFLEATTQELADACDMTIE
EMESAADDILSGGAGQSPNGTLLPCANCRDPGPDRAGGVEDAAWAPSAEPRQGAEEPRDS
RAFASGL
NT seq 6504 nt   +upstreamnt  +downstreamnt
atgctgcgagccttcttcccccactccacgcccgggtaccagccgctgccccgccgccgc
gccaacacccaggcgggctccaggggtacgctggtgcacgaggctcagctgagctgctcc
tatgtctctcctggaggtcccagctatgggagcccgcgcccggctcatgccaacatgaac
gccaacgcggccgcagggctggcgcccgagcacatccccacgccaggggccgccctgtcc
tggcaggccgccatcgacgcggcccggcaggccaagctgatgggcagtgctggcaacgcg
accatctccacggtcagctccacgcagcggaagcggcagcagtacgggaagcccaagaag
cagggcagcacgacggccacccgcccgccccgcgccctgctctgcctgaccctaaagaac
cccatccggagggcctgcatcagcatcgtcgagtggaagccatttgaaatcattatttta
ctgactatttttgccaattgtgtggccttagcgatctatattcccttcccagaggacgac
tccaacgccacgaattccaacctggagcgagtggagtatctctttctcatcatttttact
gtggaagcatttttaaaagtcatagcctacggactcctctttcaccccaacgcttacctc
cgcaatggctggaacttactagactttatcatcgtggttgtcgggcttttcagcgcgatc
ttagagcaagcgaccaaagccgatggggccaatgccctgggagggaagggtgctggattc
gacgtgaaggcactgagggcgttccgtgtgctgcggcccctgcggttggtgtccggggtc
ccgagtctccaggtggtcctgaattccatcatcaaggccatggtgcccctgctgcacatc
gccctgctcgtgctgttcgtcatcatcatctatgccatcatcggcctggagctcttcatg
ggcaagatgcataagacctgctacaaccaggagggcattgcagatgtcccagcagaagac
gacccctcgccctgtgccctggagacaggtcacgggcggcagtgccagaatggcacggtg
tgcaaaccaggctgggatgggcccaagcacggcatcaccaatttcgacaacttcgccttc
gccatgctgactgtgttccagtgcatcaccatggagggctggaccgatgtcctctactgg
atgcaggacgctatgggctacgagttaccctgggtgtattttgtcagtctggtcatcttc
ggatccttcttcgttctaaatctggttcttggtgtgttgagcggagagttctccaaagag
cgagagaaggccaaggcccggggagacttccagaagctgcgagagaagcagcagctggag
gaggacctgaagggctacctggactggatcacacaggccgaggacatcgaccccgagaat
gaggacgagggcctggatgaggagaaaccccgaaacatgagcatgcccaccagtgagacc
gagtctgtcaacaccgaaaacgtggctggaggggacatcgagggagagagctgcggggcc
aggctggcccaccggatctccaagtcgaagttcagccgctattggcgccggtggaatcgg
ttctgcaggaggaagtgccgcgcggccgtgaagtccagcatcttctactggctggtcatc
ttcctggttttcctcaacacactcaccatcgcctccgagcactacaaccagccccactgg
ctcacggaagtccaagacacggccaacaaggcgctgctggccctgttcacggcggagatg
ctgctcaagatgtacagcctgggcctgcaggcctacttcgtgtcactcttcaaccgcttt
gactgcttcatcgtgtgcggcggcatcctggagaccatcctggtggagaccaagatcatg
tcgccgttgggcatctccgtgctgcgctgcgtgcgcctcctgcggatatttaagatcaca
aggtactggaactccctgagcaacctggtggcatccctgctgaactcagtgcgctccatt
gcctcgctgctgctgctgctcttcctcttcatcatcatcttctccctcctggggatgcag
ctctttggggggaagttcaactttgatgagatgcagacccggaggagcaccttcgacaac
ttcccacagtccctcctcaccgtgtttcagatcctgaccggggaggactggaattcggtg
atgtatgatgggatcatggcttatggcggcccctcttttccagggatgttagtctgtatt
tacttcatcatcctcttcatctgtggaaattatatcctactgaacgtgttcttggccatt
gccgtggacaacctggctgacgccgagagcctcacgtctgcccagaaggaggaggaagag
gagaaggagaggaagaagctagccaggaccgccagcccagagaagaagcaagaggtggta
gagaagcaggccgtggaggagaccaaggaggagaaaattgagctgaaatccatcacggcg
gatggagagtccccacccgccaccaagatcaacatggatgacctccagcccaacgagaat
gaggacaagagttcctaccccaaccaggaaaccacaggagaagaggacgaggaggagccc
gagatgcccgtgggcccccgcccgcgccccctctctgagctgcacctgaaggagaaggca
gtgcccatgccggaagccagcgccttcttcatcttcagtcccagcaacaggttccgcctc
cagtgccatcgcatcgtcaatgactccatcttcaccaacctgattctcttcttcatcctg
ctcagcagcatctccctggccgccgaggaccccgtgcagcacacctccttcaggaaccac
attctgttttattttgacattgttttcactaccattttcaccattgagattgccctgaag
atgacggcctacggggccttcctgcacaagggctccttctgccgcaactacttcaacatc
ctggacctgctggtggtcagcgtgtccctcatctccttcggcatccagtccagtgccatc
aacgtggtgaagatcctgcgagtcctgagggtgctccggccactgagggccatcaacagg
gccaaggggctgaagcacgtcgtgcagtgcgtgttcgtggccatccgcaccatcgggaac
attgtgatcgtcaccacgctgctccagttcatgttcgcctgcattggggtccagctcttc
aagggaaagctctacacctgttcggacagttccaaacagacagaggctgaatgcaagggg
aactacatcacatacaaggatggggaggtggaccaccccatcatccagccccgcagctgg
gagaacagcaagttcgactttgacaatgtcctggcagccatgatggccctgttcaccgtc
tccaccttcgagggatggccagagttgctgtaccgctccatcgactctcacacggaggac
aagggtcccatatacaactaccgcgtggagatctccgtcttcttcatcatctacatcatc
atcattgccttcttcatgatgaacatcttcgtgggtttcgtcatcgtcaccttccaggag
cagggggagcaagaatacaagaactgcgagctggacaagaaccagcggcagtgtgtggag
tatgcactcaaggcccggcccctgcggaggtacatcccgaaaaaccagcaccagtacaaa
gtgtggtacgtggtcaactccacctacttcgagtacctgatgttcgttctcattctgctc
aacaccatctgcctggccatgcagcactacggtcagagctgtctgttcaaaatcgccatg
aacatcctcaacatgctcttcaccggcctcttcacagtggagatggtcctgaagctcatc
gccttcaagcccaagcactatttctgtgatgcatggaacacatttgacgccttgattgtt
gtgggtagcattgttgatatagccatcaccgaggtaaacccagctgaacatacccaatgc
tctccctttatgaacgcggaagagaactctcgcatctccatcaccttcttccgcctcttc
cgggtcatgcgtctggtcaagctgctgagccgcggggagggcatccggacgctgctgtgg
accttcatcaagtccttccaggccctaccctatgtggccctcctgatcgtgatgctgttt
ttcatctacgccgtgatcgggatgcaggtgtttggcaaaattgccctgaatgacacgaca
gagatcaacaggaacaacaacttccagaccttcccccaggccgtgctgctcctcttcagg
tgcgccactggggaggcctggcaggacatcatgctggcctgcatgcctggcaagaaatgc
gcccccgagtcagagccgggcaacagcacagagggggagacgccctgtggcagcagcttt
gccgtcttctacttcatcagcttctacatgctctgcgccttcctgatcatcaacctcttc
gtagccgtcatcatggacaactttgactacctgacgagggactggtccatcctgggtccc
caccacctggatgaatttaagagaatttgggcagagtatgaccctgaagccaagggacgc
atcaaacacctggatgtggtgaccctgctccgacggattcagccccccctgggttttggg
aagctgtgccctcaccgcgtggcttgcaaacgcctggtttccatgaacatgcccctgaac
agcgacgggaccgtcatgttcaatgccacgctgtttgccctggtccgtacggccctgaga
atcaagacggaagggaacctggaacaggccaatgaggagctgcgggccatcatcaagaag
atctggaaacggaccagcatgaagctgctggaccaagtggtgccgcccgcaggagatgac
gaggtcacggtgggcaagttttacgctactttcctgatccaggagtatttccggaagttc
aagaagcgcaaagagcaaggcctggtgggcaagccctcccagaggaacgccctatccctg
caggctggcctgcgcaccctgcacgacctggggcccgagatccgccgggccatctctggg
gacctgaccgccgaggaggagctggacaaggccatgaaggaggctgtgtctgcagcctca
gaagatgacatcttcaggagagctggcggcctgttcggcaaccacgtgggctactacccg
agtgacggccggggcgccttcccccagaccttcaccacccagcgccccctgcacatcagc
aaggcaggcaacagccagggggacaccgagtccccctcccacgagaagctggtggactcc
accttcacccccagcagctactcatccacaggctccaacgccaacatcaacaacgccaac
aacaccgccctgggccgctgcccccgccccgctctccactccggtgctgtcagcaccttg
gaggcccacgggccccccttgtcccctgccatccgggtgcaggaggccgcgtggaggcac
agctcccagaggtgcccctcccgggacagcccgatagccatgctgtgtcaggaagagtcc
cctggggacgagacctgtgccatgcacgtggatgagaatgcagagcgcagcagcgagccc
agcctggtctccacggagatgctctcctaccaggatgacgagaatcggcagctgactccc
cccgaggaggacaggagggacatccgtctgtccccaaagaggggcttcctgcgctccgcc
tccctaggtcggagggcctccttccaccttgaatgtctgaagcgacagaagaaccctggg
ggagacgtctctcagaagacagtcctgcctttgcatctggttcaccatcaggcgctggca
gtggcgggcctgagccccctcctgcagagaagccatcctcccgggaccctccccccacca
cgcctcacaccccccgccacacctggcccagcctggcctccgcggcctgtgcccaccctg
cggctggagggggctgagtccagcgacaagctcaccagcagcttcccatccatccactgc
gacccccacgtcggggagcccacaccctgcggggtcgttggcaccccccggagggcccgg
cccgtgtcactcactgtgcccagcccggcagggccccagggccgtccgttccatggcagt
gccagcagcctggtggaggcggtcttgatctcggaaggattggggcagtttgctcaggac
cccaggttcctcgaggccaccacgcaggagctggccgacgcctgcgacatgaccatcgag
gagatggagagcgcagccgatgacatcctcagcgggggtgccgggcagagccccaacggc
accctgctcccgtgtgcaaactgcagggacccggggccggaccgagcggggggcgtggag
gacgcagcctgggcgcccagcgccgagccccgccagggcgcagaggagccccgggacagc
agggccttcgccagcggcctgtag

DBGET integrated database retrieval system