KEGG   Bubalus bubalis (water buffalo): 102407788Help
Entry
102407788         CDS       T05912                                 

Gene name
DPH2
Definition
(RefSeq) 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 isoform X1
  KO
K17866  diphthamide biosynthesis protein 2
Organism
bbub  Bubalus bubalis (water buffalo)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bbub03012]
    102407788 (DPH2)
Translation factors [BR:bbub03012]
 Eukaryotic type
  Elongation factors
   Elongation associated factors
    102407788 (DPH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Diphthamide_syn
Motif
Other DBs
NCBI-GeneID: 102407788
NCBI-ProteinID: XP_006043288
LinkDB All DBs
Position
6
AA seq 489 aa AA seqDB search
MESTFSSPAEAALQREAGSAGLRTPLGDLDRVYELERVVGFVRDLGCQRVALQFPDQLLG
DAVAVAARLEEATGSKMFILGDTAYGSCCVDVLGAEQAGAQALVHFGPACLSPPARPLPV
AFVLGQRSVALELCAKAFEAQNPDPTAPVVLLSEPSCAHALEALATLLRPRYLDLLVSSP
ALPLPAGSLNPNPEPLERFGRRFPLAPGRCLEEYGAFYVGGSEAISDPDLDPDLSRLLLG
WAPGRPFSSCCPDTGRTQDEGIRAGRLRARRRYLIERARDARVVGLLAGTLGVAQHREAL
AHLRNLTQAAGKRSYVLALGRPTPAKLANFPEVDVFVLLACPLGTLAPQPSGSFFRPVLA
PCELEAACNPAWPPPGLAPHLTHYADLLPGSPFHVPLPPPDSELWDAPDVSLITGDLRPP
PAWKPSDDPGCSALTPKPQLELAESSPAASFLSSRSWKGLQPSLGQTPVTGAVSGRRGIA
IAYEDEGNS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggagtctaccttcagcagccctgcggaggcggcgctgcagcgagaggcaggctctgcc
gggctgcgcactcctcttggagacctggaccgagtgtacgagctggagcgagtcgttgga
tttgtccgcgacctggggtgtcagcgggtggccttgcagttccctgaccagctattggga
gatgctgtggccgtggcagcacgactggaggaggctaccgggtcgaagatgttcattctg
ggagacacagcctatggcagctgctgtgtggacgtactgggtgctgagcaagctggagct
caggcccttgtacattttggccctgcctgcttaagccctcctgcccgcccactgcccgtg
gccttcgtccttggtcagcgatctgtagccttggagctctgcgctaaggcctttgaggcc
cagaacccagaccccacagcgcctgtggtgctgctcagtgagccatcctgtgcccatgcc
ctggaggccttggccacccttctgcgcccacggtacctggacctgcttgtctccagccca
gctcttcccctgccagcaggctccctcaatccaaatcctgagcccctggagcgttttggg
cgccgcttccctttggctccagggaggtgtctggaagagtatggtgccttctatgtgggg
ggctctgaggccatctctgaccctgatcttgacccagacctaagccggctgcttttgggc
tgggcaccagggcggcccttctcctcctgctgcccagatacaggccggactcaggatgaa
ggtatccgggctgggcggctaagagcacgcagacgctatctgatagagagggccagagat
gcccgtgtggtggggctgctggcgggcacactgggtgtggcccaacaccgggaggccctg
gcacacttgcggaatttgacacaggctgctggcaagcgtagctatgtgttggcccttggg
cgacccacgcctgccaagcttgccaacttccctgaggtggacgtctttgtgctgttggcc
tgtcctctgggtacccttgccccccagccttctggcagcttcttcaggcctgtattagca
ccatgtgagctggaggctgcctgcaaccctgcatggccacctccaggcctggctccccac
ctcacacattatgcggacttattgcctggctctcccttccacgtgcccctccctccacct
gactcagagctgtgggatgccccagatgtgtcactcattactggggacctccgaccccca
cctgcctggaagccatcagatgatcctgggtgctcagccctgaccccgaagccccagctg
gagctggctgagagcagccctgcagcctcattccttagttcccggagctggaaaggactg
cagcccagcctgggtcagacgccagtgacgggagctgtcagcggaagacgaggaattgcc
atcgcctatgaggatgagggaaatagctga

DBGET integrated database retrieval system