KEGG   Bubalus bubalis (water buffalo): 102407976
Entry
102407976         CDS       T05912                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00230  Purine metabolism
bbub01100  Metabolic pathways
bbub01522  Endocrine resistance
bbub04015  Rap1 signaling pathway
bbub04020  Calcium signaling pathway
bbub04022  cGMP-PKG signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04114  Oocyte meiosis
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04261  Adrenergic signaling in cardiomyocytes
bbub04270  Vascular smooth muscle contraction
bbub04371  Apelin signaling pathway
bbub04540  Gap junction
bbub04611  Platelet activation
bbub04713  Circadian entrainment
bbub04714  Thermogenesis
bbub04723  Retrograde endocannabinoid signaling
bbub04724  Glutamatergic synapse
bbub04725  Cholinergic synapse
bbub04727  GABAergic synapse
bbub04740  Olfactory transduction
bbub04750  Inflammatory mediator regulation of TRP channels
bbub04911  Insulin secretion
bbub04912  GnRH signaling pathway
bbub04913  Ovarian steroidogenesis
bbub04914  Progesterone-mediated oocyte maturation
bbub04915  Estrogen signaling pathway
bbub04916  Melanogenesis
bbub04918  Thyroid hormone synthesis
bbub04921  Oxytocin signaling pathway
bbub04923  Regulation of lipolysis in adipocytes
bbub04925  Aldosterone synthesis and secretion
bbub04926  Relaxin signaling pathway
bbub04927  Cortisol synthesis and secretion
bbub04928  Parathyroid hormone synthesis, secretion and action
bbub04934  Cushing syndrome
bbub04935  Growth hormone synthesis, secretion and action
bbub04962  Vasopressin-regulated water reabsorption
bbub04970  Salivary secretion
bbub04971  Gastric acid secretion
bbub04972  Pancreatic secretion
bbub04976  Bile secretion
bbub05032  Morphine addiction
bbub05163  Human cytomegalovirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05200  Pathways in cancer
bbub05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102407976 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102407976 (ADCY3)
   04371 Apelin signaling pathway
    102407976 (ADCY3)
   04020 Calcium signaling pathway
    102407976 (ADCY3)
   04072 Phospholipase D signaling pathway
    102407976 (ADCY3)
   04024 cAMP signaling pathway
    102407976 (ADCY3)
   04022 cGMP-PKG signaling pathway
    102407976 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102407976 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102407976 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102407976 (ADCY3)
   04062 Chemokine signaling pathway
    102407976 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    102407976 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    102407976 (ADCY3)
   04912 GnRH signaling pathway
    102407976 (ADCY3)
   04913 Ovarian steroidogenesis
    102407976 (ADCY3)
   04915 Estrogen signaling pathway
    102407976 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    102407976 (ADCY3)
   04921 Oxytocin signaling pathway
    102407976 (ADCY3)
   04926 Relaxin signaling pathway
    102407976 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    102407976 (ADCY3)
   04918 Thyroid hormone synthesis
    102407976 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    102407976 (ADCY3)
   04916 Melanogenesis
    102407976 (ADCY3)
   04925 Aldosterone synthesis and secretion
    102407976 (ADCY3)
   04927 Cortisol synthesis and secretion
    102407976 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102407976 (ADCY3)
   04270 Vascular smooth muscle contraction
    102407976 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    102407976 (ADCY3)
   04971 Gastric acid secretion
    102407976 (ADCY3)
   04972 Pancreatic secretion
    102407976 (ADCY3)
   04976 Bile secretion
    102407976 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102407976 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102407976 (ADCY3)
   04727 GABAergic synapse
    102407976 (ADCY3)
   04725 Cholinergic synapse
    102407976 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    102407976 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    102407976 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    102407976 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    102407976 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    102407976 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102407976 (ADCY3)
   04714 Thermogenesis
    102407976 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102407976 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    102407976 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102407976 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102407976 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102407976 (ADCY3)
   05163 Human cytomegalovirus infection
    102407976 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102407976 (ADCY3)
Enzymes [BR:bbub01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102407976 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 102407976
NCBI-ProteinID: XP_006055120
LinkDB
Position
12
AA seq 1145 aa
MPRTQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSGDKLAPLAVAGVGLVLDII
LLVLCKKGLLPNRVTRRVVPYLLWLLISAQVFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDGLKGVQLLREILANVFLYLCAIVVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGEGGSRCD
YLEEKGIETYLIIASKPEVKKTAAQNGFNGSALLNGAPPSSKPSSPALIETKESNGSIHT
SGSISEEPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTAVVEILIDPWLMTN
YVTFVVGEALLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPTNGTAEMQVEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLIAGAVAVINIYAWCPIFDDYDRKRFQQHDFPMVALEKMQVFSSSGLNGTDRLPLVPSK
YSMTVMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGASITLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggacccagggcttctccgagcccgagtactccgcggagtactcggccgagtac
tcggtcagcctgccttcggaccctgaccgcggggtgggccggacccatgaaatctctgtc
cggaactcggggtcgtgcctctgcttgcctcgcttcatgcggctgaccttcgtaccagag
tccttggagaacctgtaccagacctacttcaagaggcagcgccacgagaccctgctggtg
ctggtggtcttcgcggccctcttcgactgctatgtggtggtcatgtgcgccgtggtcttc
tctggcgacaagctggcccccctggccgtggctggggtcgggctggtgttggacatcatc
cttctcgtgctctgcaaaaaggggctgctccccaaccgggtcactcggagagtggtgccc
tacctgctgtggctgctgatatcagcccaagtcttctcctacctgggcctgaacttctcc
cgtgcccacgcggccagcgacacggtgggctggcaagccttcttcgtcttctccttcttc
atcacgctgccgctcagcctcagccccattgtcatcatctccgtggtctcctgcgtcgtg
cacacactcgtcttgggggtcaccgtggcccagcagcagcaggatgggctgaagggagtg
cagttgctgagggagattctggccaacgtcttcctctacctgtgcgccatcgtcgtgggc
atcatgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tctctggaggtgaagatgaacctggaggagcagagtcagcagcaggagaaccttatgctc
tccatcctgcccaagcacgtggccgacgagatgctgaaggacatgaagaaggatgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctctttgctgacatcgtgggcttcacccagctgtcctcagcctgcagcgcccaggagctt
gtgaagctgctcaatgagctctttgcccgcttcgacaagctggcggctaaataccaccag
ctgcggattaagatcctgggcgactgttactactgcatctgtgggctgcctgactaccgg
gaggaccacgctgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtgcgggagaagacgaagactggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctggggggcgtcctcggccagaaacgctggcagtacgatgtgtggtccaccgacgtcacc
gtggccaacaagatggaggctggcggcatccctgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggagagttcgatgtggagccgggcgaggggggcagtcgctgtgat
tacctggaagagaagggcatcgagacctacctcatcatcgcttccaagccagaggtgaag
aagacagctgctcaaaacggcttcaacggctcagccctgctgaatggagcgccgccttcc
tcaaagcccagctcccctgccctcattgagaccaaggagtccaacgggagtattcacacc
agcggctctatatctgaggagcccgaggagcaagatgcccaggccgacaacccctcgttc
cccaaccctcgccggaggctgcgccttcaggacctggctgatcgcgtggtggacgcctct
gaggatgagcatgagctcaaccagctactcaacgaggcgctgctcgagcgggagtctgcc
caggtagtgaagaaaagaaacaccttcctcctgtccatgcggttcatggaccccgagatg
gaaacccgctactcggtggagaaggagaagcagagcggggctgccttcagctgctcctgc
gtcgtcctgctctgcacggccgtggtggagatcctcattgacccctggctcatgacgaac
tatgtgacctttgtggttggggaggctctgctcctgatcctgacaatctgctcgctggct
gccatctttccgcgggcctttcctaagaagcttgtggccttctctacttggattgaccgg
acgcgctgggccaggaacacctgggccatgctggccatcttcattcttgtcatggcaaac
gtggtggacatgctcagctgtctccagtactacacaggacccaccaacggcaccgcagag
atgcaggtggaggatggctgtgtggagaaccccaagtattacaactacgtggccgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtcaagctcacactcatg
ctgctcatcgcgggggccgtggctgtcatcaatatctacgcctggtgccccatctttgat
gactacgaccgcaaacgcttccagcaacacgactttccaatggtggccttagagaagatg
caggtgttttccagctcggggctcaatggcactgacaggctgcccctggtgccgtctaag
tactcgatgacagtgatgatctttgtcatgatgctgagcttttactacttctcccgccac
gtggaaaagctggcacggacactgttcttgtggaagattgaggtccacgaccagaaggaa
cgtgtctatgagatgcgacgctggaacgaagccttggtcaccaacatgctgcctgagcat
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagtcttat
gatgagattggagttatgtttgcctccctgcccaattttgctgacttctacacagaggag
agcatcaataacggtggcattgagtgtctacgcttcctcaacgagatcatctcagatttt
gactctcttctggacaatcccaagttccgtgtcatcaccaagatcaagaccattggtagc
acctacatggcagcttcaggagtcaccccagatgtcaacaccaatggctttaccagctcc
aacaaggaggagaagtcagacaaggagcgctggcagcacctggcagatctggctgatttt
gcgctggccatgaaggacacgctcaccaacatcaacaaccagtccttcaacaacttcatg
ctgcgcattggaatgaacaaaggaggggtcctggctggggtcattggagcccggaaacca
cactatgacatctggggcaacacagttaacgtagccagcaggatggagtccacaggtgtc
atgggcaacatccaggtggtggaagaaacccaagtcatccttcgagagtacggcttccgc
ttcgtgaggagagggcccatctttgtgaaagggaagggggaactgctaacctttttcttg
aagggccgagacaagctggccacattccctaacggcgcctcaatcacactgcctcaccag
gtagtagacaactcctga

DBGET integrated database retrieval system