KEGG   Bubalus bubalis (water buffalo): 102408426Help
Entry
102408426         CDS       T05912                                 

Gene name
OLR1
Definition
(RefSeq) oxidized low-density lipoprotein receptor 1 isoform X1
  KO
K08763  oxidised low-density lipoprotein receptor 1
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub03320  PPAR signaling pathway
bbub04145  Phagosome
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102408426 (OLR1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102408426 (OLR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102408426 (OLR1)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:bbub04054]
    102408426 (OLR1)
   04091 Lectins [BR:bbub04091]
    102408426 (OLR1)
Membrane trafficking [BR:bbub04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    102408426 (OLR1)
Pattern recognition receptors [BR:bbub04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   102408426 (OLR1)
Lectins [BR:bbub04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   102408426 (OLR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C Ly49 UL45 UPF0242 HemX FAM176 DUF4446 Vpu Tmemb_9
Motif
Other DBs
NCBI-GeneID: 102408426
NCBI-ProteinID: XP_006059855
LinkDB All DBs
Position
4
AA seq 275 aa AA seqDB search
MTVDDHKGMKDQLDQKPNGKTAKGTRGLRFVSSWRWYPAAVTLGVLCLGLLVTVILLILQ
LSQVSDLLKQQQANITHQEDILEGQISAQRRSEKSARESQKELKEMIETLAHKLDEKSKK
LMELHRQNLNLQEVLKEAANYSGPCPQDWLWHEENCYQFSSGPFNWEKSQENCLSLDAHL
LKINSTDELEFIQQTIAHSSFPFWMGLSMRKPNYSWLWEDGTPLTPHLFRIQGAVSHMYP
SGTCAYIQRGTVFAENCILTAFSICQKKANLLTAQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgatgaccacaagggtatgaaagatcaacttgatcagaagccaaatggtaag
acagcaaaaggtactagaggtcttcgttttgtttcctcttggaggtggtaccctgctgct
gtgactctaggggtcctttgtctgggattactggtgactgttatattgttgatactgcaa
ttatcacaggtgtctgatctcctaaagcaacagcaagcaaatattactcaccaggaagat
atcctggagggacagatttcagcccagcgccgatcagaaaaatctgcccgggagtcacag
aaggaactcaaagaaatgatagaaacccttgcccacaagctggatgagaaatccaagaaa
ctaatggaacttcatcgccagaacctgaatctccaagaagttctgaaagaggcagcaaac
tattcaggtccttgtccccaagactggctctggcatgaagaaaactgttaccaattttcc
tctggcccttttaattgggaaaaaagccaggagaactgcttgtctttggatgcccacttg
ctgaagattaatagcacagatgaactggaattcatccagcaaacaattgcccattccagt
ttccccttctggatggggttgtcaatgaggaaacccaactactcgtggctttgggaagat
ggcactcctttgacgccccacttgtttagaattcagggagctgtttcccatatgtatcct
tcagggacctgtgcatatattcaaaggggaactgtttttgctgaaaactgcattttaact
gcattcagtatatgtcaaaagaaggcgaatctattgacagcacagtga

DBGET integrated database retrieval system