KEGG   Bubalus bubalis (water buffalo): 102408428Help
Entry
102408428         CDS       T05912                                 

Gene name
ACADM
Definition
(RefSeq) medium-chain specific acyl-CoA dehydrogenase, mitochondrial isoform X1
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00071  Fatty acid degradation
bbub00280  Valine, leucine and isoleucine degradation
bbub01100  Metabolic pathways
bbub01212  Fatty acid metabolism
bbub03320  PPAR signaling pathway
Module
bbub_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
bbub_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102408428 (ACADM)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102408428 (ACADM)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102408428 (ACADM)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     102408428 (ACADM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 HpaB_N
Motif
Other DBs
NCBI-GeneID: 102408428
NCBI-ProteinID: XP_006060296
LinkDB All DBs
Position
6
AA seq 421 aa AA seqDB search
MIALFRRSSGVLRSLSHFDWRSQHTKTALQREPGSGFSFEFTEQQKEFQATARKFAREEI
IPVAAEYDKTGEYPVPLIKRAWELGLMNTHIPESCGGLGLGTFDSCLISEELAYGCTGVQ
TAIEANSLGQMPVIIAGNDQQQKKYLGRMTEEPLMCAYCVTEPVAGSDVAGIKTKAEKKG
DEYIINGQKMWITNGGKANWYFLLARSDLDPKAPTSKAFTGFIVEADSPGIQIGRKELNM
GQRCSDTRGIVFEDVRVPKENVLIGEGAGFKIAMGAFDKTRPPVAAGAVGLAQRALDEAT
KYALERKTFGKLLIEHQGISFLLAEMAMKVELARLSYQRAAWEVDSGRRNTYYASIAKAY
AGDIANQLASDAVQVFGGNGFNTEYPVEKLMRDAKIYQIYEGTAQIQRLIIAREHIGRYK
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgctgtttaggcgaagcagtggggtactgagaagtctttctcattttgactgg
agatcacaacatacaaaaactgccctacaacgtgagccaggatcaggatttagttttgaa
ttcactgaacaacagaaagaatttcaagctactgctcgtaaatttgccagggaggaaata
attccagttgctgcagaatatgataaaactggcgagtaccctgtcccattaattaaaaga
gcctgggagcttggtttaatgaatacacacattccagaaagttgtggaggtcttggactt
ggaacttttgatagctgtttaatttctgaagaattggcttatggatgtacaggggttcag
actgctattgaagcaaattctctagggcaaatgcctgttattattgctggaaatgatcaa
caacaaaagaaatatttggggagaatgactgaggagccattaatgtgtgcctattgtgta
acggaacctgtagcaggctctgatgtagctggtataaaaaccaaagcagaaaagaaagga
gatgagtatattattaatggtcagaagatgtggatcaccaatggaggaaaagctaattgg
tattttttattggctcgttctgatctggatcctaaggctcctactagtaaagcctttact
ggctttattgtggaagcagacagcccaggaatacagattggaagaaaggaattaaatatg
ggccagcgatgttcagatacaagaggaattgtctttgaagatgtgagagtgcctaaggaa
aatgttttaattggtgagggagctggtttcaaaattgcaatgggagcatttgataaaacc
agaccaccagtagcagctggtgctgtgggactggcacagagagctttggatgaagctacc
aagtatgccctggagagaaaaacttttggaaagctgcttatagagcaccaaggaatatca
tttttgctggctgaaatggcaatgaaagttgaactagctagattgagttaccagagagca
gcttgggaagttgattctggtcgccgaaatacctattatgcctctattgcaaaggcatat
gctggagatatcgcaaatcagttagcttctgatgctgttcaggtttttggaggcaatgga
tttaatactgaatatcctgtagaaaaattaatgagagatgccaagatctatcagatttat
gaaggtacagcacaaattcaaaggcttattatagcccgtgaacacattggcaggtataaa
aagtaa

DBGET integrated database retrieval system