KEGG   Bubalus bubalis (water buffalo): 102408758Help
Entry
102408758         CDS       T05912                                 

Gene name
SHANK1
Definition
(RefSeq) LOW QUALITY PROTEIN: SH3 and multiple ankyrin repeat domains protein 1
  KO
K15009  SH3 and multiple ankyrin repeat domains protein
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    102408758 (SHANK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 SAM_1 Ank_5 Ank SH3_2 SAM_2 Ank_3 PDZ_6 SH3_1 PDZ SH3_9 FERM_f0 SAM_PNT
Motif
Other DBs
NCBI-GeneID: 102408758
NCBI-ProteinID: XP_025125809
LinkDB All DBs
Position
18
AA seq 2171 aa AA seqDB search
MTHSPASSEDEERHSASECPEGGSESDSSPDGPGRGPRGTRGRGSAAPGSLASIRGLQSR
SMSVPDDAHFSMMVFRIGIPDLHQTKCLRFNPDATIWTAKQQVLCALSESLQDVLNYGLF
QPATSGRDANFLEEERLLREYPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKTGL
KKFLEYVQLGTSDKVARLLDKGLDPNYHDSDSGETPLTLAAQTEGSVEVIRTLCLGGAHI
DFRARDGMTALHKAACARHCLALTALLDLGGSPNYKDRRGLTPLFHTAMVGGDPRCCELL
LYNRAQLGISDENGWQEIHQACQRGHSQHLEHLLFYGAEPGAQNASGNTALHICALYNKE
TCARILLYRGANKDVKNNSGQTPFQVAVIAGNFELGELIRNHREQDVVPFQESPKYAARR
RGPPGTGLTVPPALLRANSDTSMALPDWMVFAAPGTSSAGAPGPTAGPQGQTQPAAPSAK
LSSGTLRSASSPRGARARSPSRGRHPEEAKRQPRGRPSSSGTPREGPAGGTGGSGGPGGS
LGSRGRRRKLYSAVPGRSFMAVKSYQAQAEGEISLSKGEKIKVLSIGEGGFWEGQVKGRI
GWFPSDCLEEVANRSQEAKQESRSDKAKRLFRHYTVGSYDSFDAPSLMDGIGPGSDYIIK
EKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGD
FLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHKKAPQQAKRLPPP
AISLRSKSMTSELEEMEYEQQPPPMPSMEKKRTVYQMALNKLDEILAAAQQTISASESPG
PGGLASLGKHRPKGFFTTESSFDPHHRSQPSYERPSYLPPGPGLMLRQKSIGAAEDDRPY
LAPPAMKFSRSLSVPGSEDIPPPPTTSPPEPPYSTPPAPSSSGRLTPSPRGGPFNPSSGG
THPASSPASFDGPAPPDTRIGIREKSLYHSGPLPPPHHHPPHHHHHHAPPPQPHHHHAHP
PHPPEMETGGSPDDPPPRLALGPQPSLRGWRGGGPSPTPGALSPSHHGSGGGAGGPSQAP
ALRYFQLPPRAASAAMYVPARSGRGRKGPLVKQTKVVEGEPQKGGGLPPAPSPTSPASPQ
PPPPPPPAAAAPSEKNSIPIPTIIIKAPSTSSSGRSSQGSSTEAEPPSQPEAAGGGGGGS
SAPSPAPAVSPVPPPPSPVPTPASPSGPATLDFTSQFGAALVGAARREGGWQNEARRRST
LFLSTDAGDEDGGDSSLGPGAPPGPRLRHSKSIDEGMFSAEPYLRLESAGAGSGSAYAGY
AAGGRAYGGSSAFTSFLPPRPLVHPLTGKALDPASPLGLALAARERALKESSEGGGPPQP
PPRPPSPRYEAPPPTPHHHSPHAHHEPVLRLWGASPPDPARRELGYRAGLGSQEKSLPAS
PPAARRSLLHRLPPTAPGVGPLLLQLGPEPPAPHPGISKPWRSGAPPEEPERLPLHVRFL
ENCQPRAGGAGGRGPPSEDGPGVPPPSPRRSVPPSPTSPRGSEENGLPLLVLPPPAPSVD
VEDGEFLFVEPLPPPLEFSNSFEKPESPLTPGPPYPLPDPPIPTTPLPPVPPPAVAAAPP
TLDSTASSLTSYDSEVATLTQGAPAAPGDPPPPGPPAPAAPAPPAPQPGPDPPPGTDSGI
EEVDSRSSSDHPLETISSASTLSSLSAEGGGGAGGGTGGVGGSGGASVAGGPELLDTYVA
YLDGQAFGGSGTPGPPYPPQLMTPSKLRGRALGAGGGLRPGPGGGLRDPITPTSPTVSVT
GAGTDGLLALSGCPGSSTAGVAGGPVAVEPEGPPVPLPSASSLPRKLLPWEEGPGPPPPP
LPGPLAQPQASALATVKASIISELSSKLQQFGGSSAAGGALPWARGGSGGSGDSHHGGAS
YVPERTSSLQRQRLSEDSQSSLLSKPVSSLFQNWSKPPLPPLPTGTAVSPSAAAAPGATS
PSASSSSTSARHLQGVEFEMRPPLLRRAPSPSLLPASEHKVSPAPRPSSLPILPSGPLYP
GLFDIRGSPTGGAGGSADPFAPVFVPPHPGMSGGLGGALSGASRSLSPTRLLSLPPDKPF
GAKPLGFWTKFDVADWLEWLGLAEHRARFLDHEIDGSHLPALTKEDYVDLGVTRVGHRMN
IDRALKFFLER
NT seq 6516 nt NT seq  +upstreamnt  +downstreamnt
atgacccacagccccgcgtcaagcgaggacgaagaacgccacagtgccagcgagtgtccc
gaggggggctcagagtccgacagctccccagacgggcccgggagaggcccccgggggacc
cggggccggggcagcgcagcacctggtagcctggcctcgatccgaggcctccagagccgc
tccatgtccgtcccagacgacgcccacttcagcatgatggtttttaggattggcatccct
gaccttcaccagacaaaatgcctgcgcttcaaccccgatgccaccatctggacggcaaag
cagcaggtgctctgtgccctgagcgagagcctccaggacgtgctcaactacggcctgttc
cagccagccacctcgggccgggacgccaacttcctggaggaggagcggctgctgcgggag
tacccccagtccttcgagaagggggtgccctacctggagttccgatacaagacccgtgtt
tacaagcagaccaacctggatgagaagcagctggccaagttgcacacgaagacggggttg
aagaagttcctggagtacgtgcagctcgggacatctgataaggtggcacggctgctggac
aaggggctggaccccaattatcatgactcagattcaggagagacccccctgacgctggct
gctcagaccgaaggctccgtagaggtgattcgaaccctatgcctgggcggggcgcacatt
gatttccgggcccgggatggcatgaccgcgctacacaaggccgcctgtgcccgccactgc
ctcgctctgacggcgctcctggatcttgggggctcccccaactacaaggaccgccgaggg
ctgactcccctgttccacacggctatggtggggggtgacccccgctgttgcgagctactc
ctgtacaacagggcccagctgggcatatctgatgagaacggctggcaggagattcaccag
gcctgccagcggggtcactctcagcatctggaacatctgctcttctacggagctgagcct
ggagcccagaacgcctcggggaacacggccctacacatctgtgccctctacaataaggag
acgtgtgctaggatccttctctatcgaggggccaacaaggatgtcaagaataacagtgga
cagacccccttccaggtggcagtgatcgctgggaattttgaactcggggagctgatccga
aaccatcgagaacaggacgtggtgcccttccaggagtcccccaaatacgcagcccggcga
cggggacccccgggcacagggctgacggtgccccccgcactgctgcgggccaacagtgat
accagcatggccctgcccgactggatggtgttcgccgccccaggaacctcgtccgcaggg
gcccccggccccaccgcagggccccagggccagacacagcccgccgcccccagcgccaag
ctcagcagcgggaccctgcgaagtgccagcagcccccggggcgcccgggcccgctcccca
tcccgcgggaggcaccctgaggaggccaagcgccagccccgtggacggcccagctccagt
gggacaccccgggaagggccagccgggggcacggggggctccgggggccccgggggctcc
ctgggcagccgcgggagacgcaggaagctctactcggcggtccccggacgctccttcatg
gctgtgaagtcctaccaggcccaagccgagggggagatctccctgagcaagggcgaaaag
atcaaagtgcttagcatcggggaaggaggcttctgggaaggccaggtcaaaggtcgcatt
ggctggttcccctctgactgcctggaagaggtggccaaccgctcccaggaagcaaagcaa
gaaagccgaagtgacaaggcaaagagactcttccggcattataccgtgggctcctacgac
agctttgatgccccaagcttgatggatgggattggcccagggagcgattacatcatcaaa
gagaagacagttctgctgcagaagaaggacagtgaggggtttgggttcgtgctccggggc
gccaaggcgcagacccccatcgaggagttcacccccaccccagccttcccggcactgcag
tatctggagtcagtggacgagggcggcgtggcatggcgggctggactgcgaatgggagac
ttcctcatcgaggtgaacgggcagaacgtggtgaaggtcggccaccggcaggtggtgaac
atgatccgccaagggggcaacacgctgatggtcaaggtggtgatggtcaccaggcacccg
gacatggatgaagctgttcacaagaaagcaccccagcaagctaagcggctcccgccccca
gccatctccttgcgttccaagtctatgacctccgagctggaggagatggagtacgagcag
cagccgccgccgatgcccagcatggagaaaaagaggactgtgtatcagatggctctcaac
aaactggatgaaatcttggcagcagctcagcagaccatcagtgcaagcgagagtcctggg
cctggtggcctggcgtccctgggtaaacaccgacccaaaggcttctttaccactgagtcg
agctttgatccccaccaccgctcccagccaagttatgaacgtccttcctacctgcctcct
ggacccgggctcatgctccgacaaaaatctattggggctgcagaggacgatagaccctac
ctagcacccccagccatgaagttcagccgcagcctgtctgtgcctggttcggaggacatc
cccccgccacccaccacgtccccaccagagcccccctacagcacgcctccagccccgtcc
tcctctgggcgcctcactccctctccccggggtgggcccttcaaccccagctcaggtggc
acccacccagcctcgtccccggcgtccttcgatgggcctgctccccctgacacccggata
gggatccgagagaagagcctgtatcacagcgggcccctgcccccaccccaccaccacccg
ccccaccaccaccaccaccacgccccgcccccccagccccaccaccaccatgcccacccg
cctcaccccccggagatggagactggcggctcccccgacgaccccccaccccgcctggct
ctggggccccagcccagcctacgaggctggcggggcggcgggcccagcccgaccccaggt
gccctgtccccgtcgcaccacggcagcgggggcggcgcgggcggcccctcccaggctccc
gcgctgcgctacttccagctgcctccgcgggcggccagcgcagccatgtatgtgcccgcc
cgttccggccgcgggcgcaagggcccgctggtcaagcagaccaaagtcgtcgaaggcgag
ccccagaagggcggcggcctcccgcctgccccctcgcccacgtctccggcgtccccgcag
ccgccgccgcctccgccgccggccgcggccgccccgtcggaaaagaactccatccccatc
cccaccatcatcatcaaggcgccgtccaccagtagcagcggccgcagcagccaggggagc
agcaccgaggcggagcccccgagccagcccgaggccgcgggcggcggcggcggcggctct
tccgcgcccagccccgccccggccgtgtcgcccgtgccgccgcccccctcgcctgtgccc
acccctgcctcgcccagcggcccggccaccctggatttcaccagccagttcggagcggcc
ctggtgggggcggctcggagggaagggggctggcagaacgaagcccgccggcggtccacg
ctcttcctctccaccgacgcgggggacgaggacggcggcgacagctcgctgggcccaggg
gcgcctccgggcccccggctgcgccactccaagtccatcgacgaaggcatgttttcggcc
gagccctacctccggctggagtcggcgggcgccggcagcggcagcgcctacgcgggctac
gcggccggcggccgagcctacgggggcagcagcgccttcaccagcttcctgccaccgcga
cccctggtccacccgctgaccggcaaggccctggacccggcctccccactcgggctggcc
ctggccgcccgggagcgggcgctgaaggagtcctcggagggcggtgggcccccccagccc
cctccaaggcccccatcgccccgctacgaggccccgccacccaccccgcaccaccactcg
ccccacgcccaccacgagccagtgctgcgcctctggggagcctcgcccccggacccggcc
cgccgggagctggggtaccgggcagggctgggcagccaggagaagtcccttccggccagc
ccaccggcggcccgacgctccttgctgcaccgcctgcctcccacagctcccggggtcggg
cccctcctgctgcagctggggcccgagccccccgccccgcaccccgggataagcaagccc
tggcgatccggcgcccccccagaggagcccgagcggctgcccctccacgtgcggttcctg
gagaactgccagccccgggccggcggtgcgggtggaagggggcccccctcggaggacggg
ccgggggtcccgccgcccagcccgcgccgctctgtgccgccctcgccgacctccccgcgg
ggcagtgaagagaacgggctccccctgctggttctgccgccgcccgccccctcggtggac
gtggaagacggagaattcctctttgtggaaccgctgcccccgcccctcgagttttccaac
agcttcgagaagccggagtcgcctctcacgccggggcctccctacccgctgccggaccca
cccatcccgaccaccccattgccccctgtgccgcccccggccgtggccgccgcccctccc
accctggactcgaccgcatccagcctgacttcctatgacagcgaggtggcaacgctgacc
cagggggcccccgcggctcctggggacccccctccgccaggccctcccgccccagccgct
ccggctcccccagccccccagcctggcccagaccctcccccgggcacggattctggtatt
gaggaggtggacagtcggagcagcagcgaccaccccctggagaccatcagcagcgcctcc
acgctgagcagcctgtcggctgaaggcgggggcggcgcagggggcggaactggcggcgtt
ggaggcagtggtggcgccagcgtggcgggtggaccagagctcctggatacctacgtggcc
tacttggatggccaggccttcgggggcagcggcactcctggccccccataccccccgcag
ctcatgactccctctaagctccggggccgggcgctcggggccggcggaggcctgcggccg
ggccccggtgggggactccgagaccctatcactcccaccagccccactgtctcggtgacg
ggggcgggaaccgatgggctgctggccctgagcggctgtccgggatcctcgacggcaggt
gtggctggcggccccgtggctgtagagccggaaggtccgccagtgcccttgccgtcggcc
tcctccctccctcgaaagctgctgccctgggaggagggcccgggcccgccgccgccccct
ctgccggggcccttagcccaacctcaggcctcagccttggccactgtaaaagccagcatc
atcagtgaactcagctccaagcttcagcagtttgggggctcctcggcagctggtggcgct
ctgccctgggcccggggaggcagcgggggaagcggggacagccaccacgggggagccagc
tacgtccccgagcggacttcctccctgcagcggcagagactctctgaagactcccagtcc
tcgctcctctccaaacccgtgagcagcctgtttcagaactggtccaaaccacctctgccg
ccacttcccacgggaaccgcggtgtccccttcagccgctgcagccccgggggccacctcc
ccatcggcttcctcctcctccacgtccgcccgccacctccagggcgtggagttcgagatg
cgcccacctttgctccgccgggcccccagcccctcattgctgcctgcctcggagcacaag
gtcagccctgcgccccggccctcgtccctacccatcctgccttccggacccctctatccg
ggcctctttgacatccgaggctcccccaccggaggggcaggaggctcggccgaccccttc
gcccccgtctttgtacctccgcaccccgggatgtccgggggtctcggcggggccttgtca
ggggcctcccgctccctctcacctacccgcctgctttccctgcccccggacaagccattc
ggcgctaaacctctgggcttctggaccaagttcgatgtggctgactggctagagtggctg
ggcttggccgaacaccgggcccggttcctggaccatgagatcgatggctcccaccttccc
gccttgaccaaggaggactacgtcgatttgggggtgaccagggtgggacaccgcatgaac
atcgaccgggctctcaagtttttcctggagaggtga

DBGET integrated database retrieval system