KEGG   Bubalus bubalis (water buffalo): 102408966Help
Entry
102408966         CDS       T05912                                 

Definition
(RefSeq) sterol 26-hydroxylase, mitochondrial
  KO
K00488  cholestanetriol 26-monooxygenase [EC:1.14.15.15]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00120  Primary bile acid biosynthesis
bbub01100  Metabolic pathways
bbub03320  PPAR signaling pathway
bbub04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    102408966
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102408966
  09154 Digestive system
   04979 Cholesterol metabolism
    102408966
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bbub00199]
    102408966
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.15  cholestanetriol 26-monooxygenase
     102408966
Cytochrome P450 [BR:bbub00199]
 Cytochrome P450, animal type
  CYP27 family
   102408966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 102408966
NCBI-ProteinID: XP_006059087
LinkDB All DBs
Position
2
AA seq 537 aa AA seqDB search
MNRMGALGSARLRWALLGTRAALPGLGSYGARAKAAIPSALPAAQAAEAPGTGPGDRRLR
SLDEISGPGQLRLLFQLLVQGYVLHLHQLQVLNKAKYGPIWINRVGPQMHVHLASAPLLE
QVMRQEGKYPVRDDMKLWKEHRDQQGLSYGPFTTMGEQWYRLRQTLNQRMLKPAEAALYT
DALNEVINDFMDQLKQLRAESASGDHVPDIAHQFYFFALEAISYILFEKRIGCLERSIPK
DTETFVRSVGLMFHNSLFVTFLPKWTRPLLPFWKRYLDGWNTIFSFGKKLIDQKLEEIEA
QLKTGNPEETQISGYLHFLLTSGQLSPREAEGSLPELLLAGVDTTSNTLTWALYHLSKNP
EIQAALHKEMVGVVPAGQVPQHKDLARMPLLKAVLKETLRLYPVVPVNSRVVVDKEIEIG
GFLFPKNTQFVLCHYVISRDPDIYPEPDSFQPQRWLRKNQPDALKTQHPFGSVPFGYGVR
ACLGRRIAELEMQLLLTRLIQHYEVVLAPETGEVTSVARIVLVPNKKVGLRFLQRQS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaatgggcgctctgggctccgcgaggctgcgatgggcgctgctggggacgcgg
gcggcactccctggcctcggctcgtacggggccagagccaaggcggcgatcccctccgcc
ctccctgcggcccaggcggctgaggctcccggaaccgggcctggcgatcggaggctgcgg
agcctggacgagatttcagggccagggcagctgcgcctcttattccagctgttggtgcaa
ggctacgttctgcatttgcaccagctccaggtgctgaacaaggccaagtacggcccaata
tggataaaccgagtagggcctcagatgcacgtgcacctggccagtgccccactcctggag
caagtgatgcgccaagagggcaagtaccctgtacgggacgacatgaaactatggaaggag
caccgggaccagcaaggcctgtcctatgggcccttcaccacgatgggagagcagtggtac
cggttgcgccagactctgaaccagcggatgctgaagccagctgaggctgcgctctacacg
gatgctctgaatgaggtgatcaatgacttcatggatcaactgaaacagctgcgggcagag
agtgcctcaggggaccacgtgcctgacatcgctcaccaattctacttctttgccttggaa
gctatttcctacatcctgtttgagaaacgtattggctgcctggagcgctccatccccaag
gacaccgagactttcgtcagatctgtggggctcatgttccataactcgctctttgtcacc
ttcctccccaagtggactcgtcccctgctgcccttctggaagcggtacctggatggctgg
aacaccatattctcttttggaaagaagctgattgatcagaaattggaggagatagaggcc
cagctgaagacagggaatccagaggagacccagatatctggttacctgcatttcctgctg
accagcggacaactcagtcctcgtgaggctgagggcagcctgcccgagctgctcttggct
ggagtagacacgacatccaacacgctgacatgggccctgtaccatctttcaaagaaccca
gagatccaggcggccttgcataaggaaatggtgggcgtggtgcccgctgggcaggtgccc
cagcacaaggacttagcccgcatgcccctgctcaaagctgtgcttaaggagaccctgcgt
ctctatcctgtggtccctgtgaactcccgggttgtcgtggacaaggaaattgaaattggt
ggcttcctctttcccaagaatacccagtttgtgctctgccactacgtgatttcccgggac
cctgacatctaccctgagcctgacagcttccagccccagcgttggctgaggaagaaccag
cctgatgccctcaaaacccagcacccatttggctctgtgccctttggctatggggttcgg
gcttgcctgggccgcaggattgcagagctggagatgcagctgctgctgacaaggctgatc
cagcactatgaggtggtcctggcccctgagacgggggaggtgacgagtgtggctcgcatc
gttctggttcccaacaagaaggtgggcctgcgtttcctgcagagacagagctga

DBGET integrated database retrieval system