KEGG   Bubalus bubalis (water buffalo): 102409904Help
Entry
102409904         CDS       T05912                                 

Gene name
TSPAN5
Definition
(RefSeq) tetraspanin-5
  KO
K17345  tetraspanin-5
Organism
bbub  Bubalus bubalis (water buffalo)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102409904 (TSPAN5)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102409904 (TSPAN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 102409904
NCBI-ProteinID: XP_006049571
LinkDB All DBs
Position
7
AA seq 268 aa AA seqDB search
MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGIAFLGIGLWAWNEKGVLSNISSITDLGGFD
PVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIK
DQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERC
GVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIF
IGIALLQIFGICLAQNLVSDIEAVRASW
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggaagcattacaagggtcctgaagtcagttgttgcatcaagtatttcatattt
ggcttcaatgtcatattttggtttttgggaatagcatttcttggaatcggactctgggcg
tggaatgaaaaaggagttctgtccaacatctcttccatcaccgatctcggcggctttgac
ccggtttggctcttcctcgtggtgggaggagtgatgttcatcctgggatttgctgggtgc
attggagctctgcgagaaaacactttccttctcaagtttttttctgtgttcctgggaatt
attttcttcctggagctcactgctggggttctggcatttgttttcaaagactggatcaaa
gaccagctgtatttctttataaacaacaacatcagagcatacagggatgacatagatttg
cagaaccttatagacttcacccaggaatattggcagtgctgtggggcttttggagctgat
gattggaacctaaatatttacttcaattgcacagattccaatgcaagtcgagagcgatgc
ggcgtgcccttctcctgctgtactaaagaccccgcggaagatgtcatcaacactcagtgt
ggctatgatgccaggcaaaaaccagaagtcgatcagcagattgtaatctacacgaaaggc
tgtgtaccccagtttgagaagtggttgcaggacaacttaaccattgtggctggtattttc
ataggcattgccttgctacagatcttcgggatctgcctggcccagaacctggtgagtgat
atcgaggctgtcagggctagctggtag

DBGET integrated database retrieval system