KEGG   Bubalus bubalis (water buffalo): 102410169
Entry
102410169         CDS       T05912                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01524  Platinum drug resistance
bbub03320  PPAR signaling pathway
bbub04068  FoxO signaling pathway
bbub04071  Sphingolipid signaling pathway
bbub04140  Autophagy - animal
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04210  Apoptosis
bbub04510  Focal adhesion
bbub04660  T cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04722  Neurotrophin signaling pathway
bbub04910  Insulin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04931  Insulin resistance
bbub04960  Aldosterone-regulated sodium reabsorption
bbub05145  Toxoplasmosis
bbub05205  Proteoglycans in cancer
bbub05213  Endometrial cancer
bbub05215  Prostate cancer
bbub05223  Non-small cell lung cancer
bbub05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102410169 (PDPK1)
   04071 Sphingolipid signaling pathway
    102410169 (PDPK1)
   04151 PI3K-Akt signaling pathway
    102410169 (PDPK1)
   04152 AMPK signaling pathway
    102410169 (PDPK1)
   04150 mTOR signaling pathway
    102410169 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102410169 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    102410169 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102410169 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102410169 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    102410169 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102410169 (PDPK1)
   03320 PPAR signaling pathway
    102410169 (PDPK1)
   04919 Thyroid hormone signaling pathway
    102410169 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102410169 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102410169 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102410169 (PDPK1)
   05231 Choline metabolism in cancer
    102410169 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    102410169 (PDPK1)
   05213 Endometrial cancer
    102410169 (PDPK1)
   05223 Non-small cell lung cancer
    102410169 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102410169 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102410169 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102410169 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102410169 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102410169 (PDPK1)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102410169 (PDPK1)
Protein kinases [BR:bbub01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   102410169 (PDPK1)
Membrane trafficking [BR:bbub04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    102410169 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH FTA2 Kdo RIO1
Other DBs
NCBI-GeneID: 102410169
NCBI-ProteinID: XP_025130856
LinkDB
Position
24
AA seq 557 aa
MARTTSQLYDTVPIQSSVVLCSCPSPSMVRTQTESSTAPGVPSGGSRQGPAMDGTAAQPR
ASASALQHAAQPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHII
KENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDE
TCTRFYTAEMVSALEYLHGKGIVHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARA
NSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEY
DFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESISWEDLHHQTPPKLT
AYLPAMSEDDEDCYGNYDNLLSQFGCMQVSASSSSHSLSAVDTGLPQRVGSNIEQYIHDL
DTNSFELDLQFSEDEKRLLLEKQASGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLT
EGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKI
QEVWRHRYQSHPDAAVQ
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacacggttcccattcagtccagcgtggtgtta
tgctcctgcccatccccatcaatggtgaggacccagactgagtccagcacggcccccggc
gttcccagcggggggagcaggcagggccccgccatggacggcaccgcggcccagccccgg
gcgagcgccagcgctctgcagcacgccgcgcagcccccgcagcctcggaagaaacggccc
gaggacttcaaattcgggaagattctcggtgaaggctcgttttcaacagttgtcctggcc
cgagaactggcaacctcaagggaatatgctattaaaattctagagaaacgccacattatc
aaagagaacaaagtcccgtatgtaaccagagagcgagacgtgatgtcgcggctggatcat
cccttctttgttaaactttacttcacgtttcaggatgatgaaaagctgtattttggcctt
agttatgccaaaaatggagaactacttaaatacattcggaaaatcggttcatttgatgag
acgtgcacccgcttttacacggccgagatggtgtccgccctggagtacttgcacggcaag
ggcatcgtccacagggacctgaaaccagaaaatattttgttaaatgaagacatgcacatc
cagatcacagattttggaacagcgaaagtattatccccagagagtaaacaagccagggcc
aactcgtttgtgggaacagcccagtatgtctctccagagctgctcacagagaaatcggcc
tgtaagagttcagacctttgggcacttggatgcatcatataccagcttgtggcaggactg
cctccgttccgagccggaaatgagtatcttatatttcagaagatcattaagttggagtat
gactttcctgaaaaattctttcctaaggcgagagatcttgtggaaaaacttctggtttta
gatgccacaaagcgattaggctgtgaagaaatggaggggtatggccctctgaaagcccac
ccgttctttgagtccatctcgtgggaggacctgcatcaccagacgcccccgaagctcacg
gcttacttgccggccatgtcggaagacgacgaggactgctatggcaactacgacaatctc
ctgagccagttcggctgcatgcaggtgtccgcgtcctcctcctcgcactccttgtcggcc
gtggacacgggcctgccccagcgggtgggcagcaacatcgagcagtacatccacgacctg
gacacgaactcctttgaactggacttacagttttctgaagacgagaagaggttgttgttg
gagaagcaggccagcggaaacccttggcaccagtttgtagaaaataatttaatactaaaa
atgggtccagtagacaagcggaagggtttatttgcacggcgacgacagttgctgctcacg
gaagggccacacttgtattacgtggatcctgtcaacaaagtcttgaaaggtgaaattcca
tggtcacaagaactccgaccagaggccaagaattttaaaactttctttgtgcacacgcca
aacaggacatattacctgatggaccccagcgggaacgcgcataagtggtgccgaaagatc
caggaggtgtggcggcacaggtaccagagccacccggatgccgccgtgcagtga

DBGET integrated database retrieval system