KEGG   Bubalus bubalis (water buffalo): 102411133
Entry
102411133         CDS       T05912                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01522  Endocrine resistance
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04115  p53 signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04218  Cellular senescence
bbub04310  Wnt signaling pathway
bbub04340  Hedgehog signaling pathway
bbub04371  Apelin signaling pathway
bbub04390  Hippo signaling pathway
bbub04510  Focal adhesion
bbub04530  Tight junction
bbub04630  JAK-STAT signaling pathway
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04934  Cushing syndrome
bbub05160  Hepatitis C
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05169  Epstein-Barr virus infection
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05216  Thyroid cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102411133 (CCND1)
   04340 Hedgehog signaling pathway
    102411133 (CCND1)
   04390 Hippo signaling pathway
    102411133 (CCND1)
   04371 Apelin signaling pathway
    102411133 (CCND1)
   04630 JAK-STAT signaling pathway
    102411133 (CCND1)
   04068 FoxO signaling pathway
    102411133 (CCND1)
   04151 PI3K-Akt signaling pathway
    102411133 (CCND1)
   04152 AMPK signaling pathway
    102411133 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102411133 (CCND1)
   04115 p53 signaling pathway
    102411133 (CCND1)
   04218 Cellular senescence
    102411133 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102411133 (CCND1)
   04530 Tight junction
    102411133 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102411133 (CCND1)
   04921 Oxytocin signaling pathway
    102411133 (CCND1)
   04919 Thyroid hormone signaling pathway
    102411133 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102411133 (CCND1)
   05206 MicroRNAs in cancer
    102411133 (CCND1)
   05205 Proteoglycans in cancer
    102411133 (CCND1)
   05203 Viral carcinogenesis
    102411133 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102411133 (CCND1)
   05212 Pancreatic cancer
    102411133 (CCND1)
   05225 Hepatocellular carcinoma
    102411133 (CCND1)
   05226 Gastric cancer
    102411133 (CCND1)
   05214 Glioma
    102411133 (CCND1)
   05216 Thyroid cancer
    102411133 (CCND1)
   05221 Acute myeloid leukemia
    102411133 (CCND1)
   05220 Chronic myeloid leukemia
    102411133 (CCND1)
   05218 Melanoma
    102411133 (CCND1)
   05219 Bladder cancer
    102411133 (CCND1)
   05215 Prostate cancer
    102411133 (CCND1)
   05213 Endometrial cancer
    102411133 (CCND1)
   05224 Breast cancer
    102411133 (CCND1)
   05222 Small cell lung cancer
    102411133 (CCND1)
   05223 Non-small cell lung cancer
    102411133 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102411133 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102411133 (CCND1)
   04934 Cushing syndrome
    102411133 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102411133 (CCND1)
   05162 Measles
    102411133 (CCND1)
   05160 Hepatitis C
    102411133 (CCND1)
   05163 Human cytomegalovirus infection
    102411133 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102411133 (CCND1)
   05169 Epstein-Barr virus infection
    102411133 (CCND1)
   05165 Human papillomavirus infection
    102411133 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102411133 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102411133
NCBI-ProteinID: XP_006072419
LinkDB
Position
5
AA seq 295 aa
MAHQLLCCEMETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLHMELVLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVAAAAQGLHLGSANGFLSYHRLTRFLSKVIRCD
PDCLRACQEQIEALLESSLRQAQQQNLDPKAAEEEEEEEEVDLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgagatggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgagtgctgcgggccatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaagaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctcgaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacactgacaactccatccggcccgacgagctgctgcacatg
gagctggtcctggtgaacaaactcaagtggaacctggcggccatgaccccgcacgacttc
atcgagcacttcctctccaaaatgccggtggccgaggagaacaagcagatcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagacgtgaagttcatttccaacccgccc
tccatggtggccgccgggagcgtggcggccgcggctcaaggcctgcacctgggaagcgcc
aacggcttcctctcctatcaccgcctgacacggttcctctccaaggtgatcagatgtgac
ccggactgcctccgcgcctgccaggagcagatcgaagccctcctggagtccagcctgcgc
caggcccagcagcagaacttggaccccaaagccgcggaggaggaagaagaggaggaggag
gtggacctggcctgcacgcccaccgacgtgcgtgacgtgaacatctga

DBGET integrated database retrieval system