KEGG   Bubalus bubalis (water buffalo): 102411862Help
Entry
102411862         CDS       T05912                                 

Gene name
CPT2
Definition
(RefSeq) LOW QUALITY PROTEIN: carnitine O-palmitoyltransferase 2, mitochondrial
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00071  Fatty acid degradation
bbub01212  Fatty acid metabolism
bbub03320  PPAR signaling pathway
bbub04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102411862 (CPT2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102411862 (CPT2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102411862 (CPT2)
Enzymes [BR:bbub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102411862 (CPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf Cohesin_HEAT Tri3
Motif
Other DBs
NCBI-GeneID: 102411862
NCBI-ProteinID: XP_006063869
LinkDB All DBs
Position
6
AA seq 658 aa AA seqDB search
MVARLLLRSWSRGLAVGPGAPCRPLSTGFEPSQYLQRSIVPTMHYQDSLPRLPIPKLEDT
IRRYLSAQKPLLDDSQFRKTEQLCKSFETGIGKELHEQLVAQDKQNKHTSYISGPWFDMY
LTARDPVVLNFNPFISFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRADLLEPEVFHLNP
AKSDTDTFKRFIRFVPSFLSWYGAYLVNAYPLDMSQYYRLFNSTRLPRPHRDELFTDDKA
RHLLVLRKGHFYIFDVLDQDGNIVSASEIQAHLKYILSDNSPAPEFPLSYLTSENRDIWA
ELRQKLVSGGNEETLRKVDSAVFCLCLDDFPIKDFVHLSHSMLHGDGTSRWFDKSFNLIV
AKDGTAAIHFEHAWGDGVAVLRFFNEVFKDSTQAPAITPQSQPASTDSSVAVQKLNFKLS
DALKTGISAAKEKFDATVKSLTIDYIRFQRGGREFLKKQKLSPDSMAQLAFQMAFLRQYG
QTVATYESCSTAAFKHGRTETIRPASVFTKRCSEAFVREPSKHSAGELQQMMAKCSTYHN
QLTREAAMGQGFDRHLFALRYLAAARGISMPELFLDPAYKQINHNILSTSTLSSPAVNIG
CFAPVVPDGFGIGYAVQDNWIGCNVSAYQSRNAHEFLQCVEKALEDMFDALEGKRIKT
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggtggcccgcctgctgctgcgctcttggtcccggggccttgccgttggcccgggagcc
ccctgtcggcccttgagcaccggcttcgagcccagccagtacctgcagcgcagcatcgtg
cccactatgcactaccaggacagcctgcccaggctgcctattcccaaacttgaagacacc
attaggagatacctcagtgcacagaagcctctgttggatgacagccagttcaggaaaaca
gaacagttgtgtaagagttttgaaactggaattggaaaagaactacatgagcagctggtt
gctcaggacaagcagaataaacatacaagctacatttcaggcccctggtttgatatgtat
ttaactgctcgagatcctgttgtcctgaactttaatccgtttatctcattcaaccctgat
ccaaagtccgagtataatgaccagctcacccgggccaccaacatgactgtctctgccatc
cggtttctgaagacacttcgggctgaccttctggagccagaagtgttccatttgaaccct
gccaaaagtgataccgataccttcaagagattcatacgctttgtgccttccttcctatct
tggtatggcgcctacttggtcaatgcatatcccctggacatgtcccagtattatcggctt
ttcaattcaactcgtttacccagaccccatcgagatgaactcttcaccgatgacaaggcc
agacacctcctggtcctaagaaaaggacatttctacatctttgatgtcctggatcaagat
gggaacattgtgagtgcctctgaaatccaggctcatctgaagtacattctgtcagacaat
agcccggcccccgagtttccactttcctatctgactagtgagaaccgggacatctgggca
gagctcagacagaagctggtgagtggtggcaacgaggagaccctgaggaaagtggactcg
gctgtgttctgtctctgcctagacgacttccccattaaggactttgtccacttgtcccac
agcatgctgcacggtgacggcacaagccgctggtttgacaaatcctttaacctcattgta
gccaaggatggcactgctgccatccactttgagcacgcctggggcgatggtgttgcagtg
ctcaggttttttaatgaagtgtttaaagatagcactcaggcccctgccatcactccccag
agccagccggccagcactgactcttctgtggccgtacaaaaactcaacttcaagctgagc
gatgctttaaagactggcattagcgctgctaaggaaaaatttgatgccaccgtgaaaagc
ctcaccattgactacatccggtttcagagaggaggcagagaattcctgaagaagcagaag
ctgagccctgactcgatggctcagctggccttccagatggccttcctgcggcagtacggg
cagacagtggccacctacgagtcctgtagcactgcagcattcaagcacggccgcaccgag
accatccgcccagcctccgtcttcacaaagaggtgctccgaggcctttgtcagggagcct
tccaagcatagcgctggagagcttcagcagatgatggccaagtgctccacataccacaac
cagctgaccagagaagcagcgatgggccagggctttgatcgacacttgtttgctctgcgg
tacctggcagcagccagagggatcagcatgcctgagctgttcctggaccctgcatataag
cagataaaccacaacatcctgtccacaagcacactgagcagcccagcagtgaatatcggc
tgctttgcccccgtggtccctgatggtttcggcattgggtacgcagttcaggacaactgg
ataggctgcaatgtctctgcctaccaaagccgcaatgcccatgagtttctccagtgtgtg
gagaaggccttagaagacatgtttgatgccttggaaggcaaaaggatcaaaacctag

DBGET integrated database retrieval system