KEGG   Bubalus bubalis (water buffalo): 102412874Help
Entry
102412874         CDS       T05912                                 

Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102412874
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102412874
   00982 Drug metabolism - cytochrome P450
    102412874
   00983 Drug metabolism - other enzymes
    102412874
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102412874
   05204 Chemical carcinogenesis
    102412874
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102412874
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102412874
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102412874
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbub02000]
    102412874
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102412874
Transporters [BR:bbub02000]
 Other Transporters
  Pores ion channels [TC:1]
   102412874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 102412874
NCBI-ProteinID: XP_006050156
LinkDB All DBs
Position
23
AA seq 241 aa AA seqDB search
MSGGSARSLGKGSDPPGPVPEGLIRVYSMRFCPYAQRTRLVLTAKGIRHEVININLKNKP
EWFFKKNPSGLVPVLETSQGQLICESAITCEYLDEAYPEKKLLPGDPYEKACQKMVLESF
SKVPLLISRILRTQNKEDCSGLKEELHKEITKLEEVLTDKKTTFFGGSSLSMIDYLIWPW
FERLEALELNECVDHAPTLKLWMAAMKKDPTVSSLLTDVKTFQGFFNLYLQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaggatcagctaggagcctgggcaagggaagcgaccccccggggcccgtcccc
gagggcctgatccgtgtctacagcatgaggttctgcccgtatgcccagaggactcgcctg
gtcctgacggccaagggtatccggcatgaagtcatcaacatcaacctgaaaaataagcct
gagtggttcttcaagaagaatccctcaggcctggtgccggttctggaaaccagtcagggt
caattgatctgtgaatctgccatcacttgtgagtacctggatgaagcatatccagagaag
aagctgttgccaggtgacccctatgagaaagcttgccaaaagatggtcttggagtccttt
tctaaggtaccacttttgatatcgaggattcttagaacacaaaataaggaagactgctct
ggcctaaaagaagaattgcataaagaaatcaccaagctagaggaggttctgactgataag
aagacaaccttctttggtggcagttctctttctatgattgattacctcatctggccctgg
tttgaacggctggaagctctggagttgaatgagtgcgtagaccacgctccaactcttaag
ctgtggatggcagccatgaagaaggatcccacagtatcatctctcctcactgatgtgaag
acctttcaaggtttcttcaacctctacttgcagaacagccctgaggcttgtgactatgga
ctctga

DBGET integrated database retrieval system