KEGG   Bubalus bubalis (water buffalo): 102413543
Entry
102413543         CDS       T05912                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04010  MAPK signaling pathway
bbub04020  Calcium signaling pathway
bbub04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102413543 (CACNA1E)
   04020 Calcium signaling pathway
    102413543 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102413543 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bbub04040]
    102413543 (CACNA1E)
Ion channels [BR:bbub04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102413543 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 102413543
NCBI-ProteinID: XP_025141305
LinkDB
Position
5
AA seq 2311 aa
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMARDSSDEHCVDISSVGTPLARASIKSAKVDGASYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLSAHPSLYRRPRAIEGLALGL
GLEKCEEERISRGGSLKGDGGDLASALDSQRSPLALGKREPSWLARPCHGNCDPTQPEVG
SGETVVTFGDRARHRQSQRRSRHRRVRTDGREPSSTSRSRSASQERSLDEAVPGEGERDH
EPRAGHGGKEPMIQEEQRERCQDLRRTNSLMVPRGSGLAGALDAADTPLVPPQPELDVGK
DAALTEQEPEGSSEQALLGDVKLDMGRVSQSEPDLSCVTANTDKATTESTSLTVTIPDVG
PLVDSTVVHISNKTDGEASPLKEAEIREDEEEVEKQQQKKEKRETGKAMVPHSSMFIFST
TNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFT
FEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLR
VLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYC
TDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVL
QHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECS
LEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMK
YYSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEII
LTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLF
FIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGC
EPDTTAPSGQSESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGP
HHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVA
EDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMP
KASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKAL
PYLQQDPVPGLSGRSAYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQP
SNHGIYLPSDTQEHAGSGKASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFS
MERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVS
RCNSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSVSDSSTPRRSRRQ
LPPVPPKPRPLLSYSSLIRHAGSISPPADGSEGGSPLTSQALESNDAGLPESSNPRQGHP
SPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGH
YRRRRRGGPGPGMTCGAVSDLLSDTEEDDKC
NT seq 6936 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccggggtcgggcgatggagactcggac
cagagcaggaaccggcaaggaacccctgtgccggcctcagggccggcggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccctattcccgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tacgccaagaagctcatcgattggccgccgtttgagtacatgatcttggccaccatcatt
gccaattgcatcgtcttggccctggagcaacatcttcctgaggatgacaagactccaatg
tcccgcagactggagaagacagaaccctatttcattgggatcttttgctttgaagctggg
atcaaaatcgtggccctggggttcatcttccataagggatcatacctccgcaatggttgg
aatgtcatggacttcatcgtggtcctcagtggcatcctggctactgcgggaacccacttc
aacacccatgtggatctgaggaccctccgggccgtgcgtgtcctgaggcccctgaagctc
gtgtcggggatacctagcctacagattgtgttgaagtccatcatgaaggccatggtgcct
ctcctgcagattggccttctgctcttctttgccatcctgatgtttgctatcatcggcttg
gagttctacagtggaaagttgcaccgagcctgcttcatgaacaattcaggtattctagaa
ggatttgacccccctcacccatgtggtgtgcagggctgcccagctggttatgaatgccgg
gactggatcggccccaatgatgggatcacccagtttgataacatcctttttgctgtgctg
actgtgttccagtgcatcaccatggaagggtggaccaccgtgctgtacaataccaatgat
gccttaggagccacctggaattggctgtacttcatccccctcatcatcattggatccttc
tttgttctcaaccttgtcctgggagtgctttccggggaatttgccaaagagagagagaga
gtggagaaccggagagccttcatgaaactgcggcgccagcagcagatcgagcgtgagctt
aacgggtaccgcgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaacaaa
aatgctggaacatcagccttagaagtgcttcggagggcaaccatcaaaaggagccggacc
gaggcaatggcacgggactccagtgacgagcactgtgtggacatctcctctgtgggcaca
cctcttgcccgagccagcatcaagagcgccaaggtggatggggcttcctatttccggcac
aaggagcgacttttgcgaatctctatccgccacatggttaagtcccaggtgttctactgg
atcgtgctgagcctggtggctctcaacaccgcctgtgtggccatcgtccaccacaaccag
ccccagtggctcacccacctcctctactatgcagagtttctgtttctggggctcttcctt
ctagagatgtccctgaagatgtacggcatggggcctcgcctttattttcactcttccttc
aactgctttgactttggggtcacagtgggcagcatctttgaagtagtctgggccatcttc
agacctggtacatctttcggaatcagtgtcctgcgagctctccggcttctaagaatattt
aaaataaccaagtattgggcatctctccggaatttggtggtctccttgatgagttccatg
aagtctatcatcagtttactcttcctccttttcctcttcatcgttgtctttgctctgcta
ggaatgcagctgtttgggggcaggttcaactttaatgatgggactccttccgcaaacttt
gacaccttccctgcagccatcatgactgtattccagatcctgacgggtgaggactggaat
gaggtgatgtacaatgggatccgctcccagggtggggtcagctcgggcatgtggtctgca
atctatttcattgtgctcaccttgtttggaaactacacactgctgaatgtgttcttggcc
atcgctgtggacaatctggccaacgcccaggagctgaccaaggatgaacaagaagaagag
gaggccttcaaccagaagcatgcgctgcagaaggccaaggaggtcagcccgatgtctgca
cccaacatgccttccatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgagggagcggaggcgccggcatcacatgtccgtgtgggagcag
cgaaccagccagttgaggaggcacatgcagatgtccagccaggaggccctcaacaaggag
gaggccccgcccatgaaccccctcaaccccctcaacccgctgagccccctcaacccgctc
agcgcacaccccagcctctaccggagaccccgggccatcgaggggctagccctgggcctg
gggctggagaagtgtgaggaagagcgcatcagccgcggggggtccctcaagggggacgga
ggggacttggcgagcgccctggacagccagaggagccccctggccctgggcaaacgggag
ccatcctggctggcccggccctgtcacgggaactgtgacccgacccagccggaggtgggc
agcggggagacggtggtgaccttcggggaccgggctcggcacaggcagagccagcggcgc
agccggcaccgccgcgtcaggaccgacggcagggagccctcctccacctccagaagcagg
tctgccagccaggagcggagtctggacgaagctgtgcccggcgagggggagagggaccat
gagcccagggccggccacgggggcaaagaacccatgatccaggaggaacagcgagagcga
tgccaggacttacggaggaccaacagcctgatggtgcccagaggctccgggctggcaggc
gccctggatgcagccgacacaccccttgtcccaccccagccggagctggacgtggggaag
gacgcagccctgacggagcaggagccggagggcagcagtgagcaggctctgctgggggac
gtgaagctggacatgggccgggtcagccagagcgagcccgacctctcctgcgtcacggcc
aacacggacaaggccaccaccgagagcaccagcctcactgtcaccatccccgacgtgggc
cccttggtggactcaaccgtggtgcacatcagcaacaagactgatggagaagccagtccc
ttgaaagaggcagagatcagagaggatgaggaggaggtggagaagcagcagcagaagaag
gagaagcgtgagacgggcaaggccatggtgccccacagctcgatgttcatcttcagcact
accaacccgatccgcagggcctgccactacattgtgaacctgcgctacttcgagatgtgc
atcctcctggtgatcgcagccagcagcatcgccctggcggccgaggaccccgtcctgacc
aactcagagcgcaacaaagtgctgaggtattttgactatgtgttcactggcgtgttcacc
tttgagatggttataaagatgatagaccagggcttgattctgcaggacggctcctacttc
cgagacctgtggaacatcctggactttgtggtggtggttggcgcattggtggcctttgct
ctggcgaatgctttgggaactaacaagggccgggatattaagaccatcaagtccctgagg
gttctccgtgtcctgaggccgctgaagaccatcaagcgcctgcccaagctcaaggctgtc
ttcgactgtgtggtcacctccttgaaaaacgtcttcaacatactcattgtctataagctc
ttcatgttcatctttgctgtcatcgcggttcagcttttcaagggcaagttcttctactgc
acggacagttccaaggacacagagaaggagtgcataggcaactatgtagatcacgagaaa
aacaagatggaggtgaaaggccgagagtggaagcgccatgaattccattatgacaacatc
atctgggctctgctgaccctcttcactgtctccacaggggaaggatggcctcaagtcttg
cagcactcggtcgatgtgacagaggaagaccgaggcccgagccgcagcaaccggatggag
atgtccatcttttacgtggtctactttgtggtcttccctttcttctttgtcaacatcttt
gtggctctcatcatcatcaccttccaggagcaaggggacaagatgatggaagagtgcagc
ctggagaagaacgagagggcgtgcatcgacttcgccatcagcgccaaaccactcacccgc
tacatgccccagaacaggcacaccttccagtaccgcgtctggcacttcgtggtgtctcca
tcctttgagtacaccatcatggccatgatcgccctgaacaccgtcgtgctgatgatgaag
tactactctgctccctgtacctatgagctggccctgaagtacctaaatatcgccttcacc
atggtgttttccctggaatgtgtcctgaagatcattgcatttggcttcttgaactatttc
cgagacacctggaatatctttgacttcatcactgtgattggcagtatcacagaaattatt
ctgacggacagcaagctggtgaacactagcggcttcaacatgagctttctgaagctcttc
cgagcggcccgcctcatcaagctgctgcgtcagggctacaccatccgcattttactgtgg
accttcgtgcagtcctttaaggcccttccctatgtctgccttctgatcgccatgcttttc
ttcatctacgccatcattgggatgcaggtctttggaaacataaagttagatgaggagagt
cacatcaaccggcacaacaacttccggagtttctttgggtccctcatgctgctcttcagg
agtgccacgggtgaggcctggcaggagataatgctgtcatgtcttggggagaagggctgt
gagcccgacaccactgcgccgtcggggcagagcgagagcgagcgctgtggcaccgatctg
gcctacgtgtacttcgtctccttcatcttcttctgctccttcctgatgctcaacctgttc
gtggctgtcatcatggacaactttgagtacctgactcgggactcatccatcctggggcct
caccacctggacgagtttgtccgtgtctgggcagagtatgacagagcagcatgtggccgc
atccattacactgagatgtatgaaatgctgactctcatgtcaccgccgctaggcctcggc
aagagatgtccctccaaggtggcatataagaggttggtcttgatgaacatgccagtggcc
gaggacatgaccgtccacttcacttccacgctgatggctctaatccggacagctctggac
attaaaatcgccaaaggtggtgcagacaggcagcagctagactcagagctccagaaggag
accctggccatctggcctcacctgtcccagaagatgctggatctgctcgtgcccatgccc
aaagcctctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactactac
aaacagagcaaggtgaagaagcagaggcagcagctggaggaacagaaaaatgcacccatg
ttccagcgcatggagccctcgtctctgcctcaggagatcattgctaatgccaaagccctg
ccttatctccagcaggaccccgttccaggcctgagtggccggagtgcatacccttcgatg
agtccactctccccgcaggaaatattccagttagcctgtatggacccagctgatgatgga
cagttccaggaacaacaatctctggagccagaggttagtgaattaaaaagcgtgcagccc
tctaaccatggcatctaccttccttcggacacccaggagcatgcgggctctgggaaggca
tcctctatgccacgcctgactgtggatccccaggtggtgacagaccccagctccatgaga
cgttcattttccaccattcgcgataagcgttcaaattcctcgtggctggaggaattctcc
atggagcgaagcagcgaaaacacctacaagtcgcggcgccggagttaccactcctccctg
aggctgtcagcccaccgtctgaactcagactcaggccacaagtccgacacccaccgctcg
gggggcagagagcggggacgatcgaaagagcgaaagcatcttctctctcctgacgtctcc
cgctgcaactccgaggagcgagggacccaggccgactgggagtccccagagcgccgtcag
tcccggtctcccagtgaaggcaggtcacagacccccaacagacagggcacggggtccctg
agtgagagctccatcccctccgtctccgactccagcaccccacgacgaagtcggcggcag
ctcccaccggtccctcccaagcctcggcccctcctttcctacagttctctgatcagacac
gctgggagcatctccccaccagctgatgggagcgagggtggctccccactgacctcccaa
gctctggagagcaacgacgccggcctgcccgagtcttccaacccccggcagggccacccc
tccccacagcgctacatctccgagccctacctggccctgcacgaagactcccacgcctcg
gactgcggcgaggaggagacgctcacctttgaagcagccgtggccaccagcctgggccgg
tccaacaccatcggctcggccccgcccctgcggcacagctggcagatgcccaatgggcac
tatcggcggcggaggcgcgggggtcctggaccgggcatgacgtgcggagctgtcagcgac
ctcctgagtgacacggaagaagacgacaagtgctag

DBGET integrated database retrieval system