KEGG   Bubalus bubalis (water buffalo): 102413748Help
Entry
102413748         CDS       T05912                                 

Gene name
PLCB3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00562  Inositol phosphate metabolism
bbub01100  Metabolic pathways
bbub04015  Rap1 signaling pathway
bbub04020  Calcium signaling pathway
bbub04022  cGMP-PKG signaling pathway
bbub04062  Chemokine signaling pathway
bbub04070  Phosphatidylinositol signaling system
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04261  Adrenergic signaling in cardiomyocytes
bbub04270  Vascular smooth muscle contraction
bbub04310  Wnt signaling pathway
bbub04371  Apelin signaling pathway
bbub04540  Gap junction
bbub04611  Platelet activation
bbub04621  NOD-like receptor signaling pathway
bbub04713  Circadian entrainment
bbub04720  Long-term potentiation
bbub04723  Retrograde endocannabinoid signaling
bbub04724  Glutamatergic synapse
bbub04725  Cholinergic synapse
bbub04726  Serotonergic synapse
bbub04728  Dopaminergic synapse
bbub04730  Long-term depression
bbub04750  Inflammatory mediator regulation of TRP channels
bbub04911  Insulin secretion
bbub04912  GnRH signaling pathway
bbub04915  Estrogen signaling pathway
bbub04916  Melanogenesis
bbub04918  Thyroid hormone synthesis
bbub04919  Thyroid hormone signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04922  Glucagon signaling pathway
bbub04924  Renin secretion
bbub04925  Aldosterone synthesis and secretion
bbub04926  Relaxin signaling pathway
bbub04927  Cortisol synthesis and secretion
bbub04928  Parathyroid hormone synthesis, secretion and action
bbub04929  GnRH secretion
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04934  Cushing syndrome
bbub04961  Endocrine and other factor-regulated calcium reabsorption
bbub04970  Salivary secretion
bbub04971  Gastric acid secretion
bbub04972  Pancreatic secretion
bbub04973  Carbohydrate digestion and absorption
bbub05010  Alzheimer disease
bbub05016  Huntington disease
bbub05142  Chagas disease (American trypanosomiasis)
bbub05143  African trypanosomiasis
bbub05146  Amoebiasis
bbub05163  Human cytomegalovirus infection
bbub05200  Pathways in cancer
Module
bbub_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102413748 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102413748 (PLCB3)
   04310 Wnt signaling pathway
    102413748 (PLCB3)
   04371 Apelin signaling pathway
    102413748 (PLCB3)
   04020 Calcium signaling pathway
    102413748 (PLCB3)
   04070 Phosphatidylinositol signaling system
    102413748 (PLCB3)
   04072 Phospholipase D signaling pathway
    102413748 (PLCB3)
   04071 Sphingolipid signaling pathway
    102413748 (PLCB3)
   04022 cGMP-PKG signaling pathway
    102413748 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102413748 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102413748 (PLCB3)
   04621 NOD-like receptor signaling pathway
    102413748 (PLCB3)
   04062 Chemokine signaling pathway
    102413748 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    102413748 (PLCB3)
   04922 Glucagon signaling pathway
    102413748 (PLCB3)
   04929 GnRH secretion
    102413748 (PLCB3)
   04912 GnRH signaling pathway
    102413748 (PLCB3)
   04915 Estrogen signaling pathway
    102413748 (PLCB3)
   04921 Oxytocin signaling pathway
    102413748 (PLCB3)
   04926 Relaxin signaling pathway
    102413748 (PLCB3)
   04918 Thyroid hormone synthesis
    102413748 (PLCB3)
   04919 Thyroid hormone signaling pathway
    102413748 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    102413748 (PLCB3)
   04916 Melanogenesis
    102413748 (PLCB3)
   04924 Renin secretion
    102413748 (PLCB3)
   04925 Aldosterone synthesis and secretion
    102413748 (PLCB3)
   04927 Cortisol synthesis and secretion
    102413748 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102413748 (PLCB3)
   04270 Vascular smooth muscle contraction
    102413748 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    102413748 (PLCB3)
   04971 Gastric acid secretion
    102413748 (PLCB3)
   04972 Pancreatic secretion
    102413748 (PLCB3)
   04973 Carbohydrate digestion and absorption
    102413748 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102413748 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102413748 (PLCB3)
   04725 Cholinergic synapse
    102413748 (PLCB3)
   04728 Dopaminergic synapse
    102413748 (PLCB3)
   04726 Serotonergic synapse
    102413748 (PLCB3)
   04720 Long-term potentiation
    102413748 (PLCB3)
   04730 Long-term depression
    102413748 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    102413748 (PLCB3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102413748 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102413748 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102413748 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102413748 (PLCB3)
   05016 Huntington disease
    102413748 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102413748 (PLCB3)
   04934 Cushing syndrome
    102413748 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102413748 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102413748 (PLCB3)
   05142 Chagas disease (American trypanosomiasis)
    102413748 (PLCB3)
   05143 African trypanosomiasis
    102413748 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102413748 (PLCB3)
Enzymes [BR:bbub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102413748 (PLCB3)
Membrane trafficking [BR:bbub04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102413748 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102413748 (PLCB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2
Motif
Other DBs
NCBI-GeneID: 102413748
NCBI-ProteinID: XP_006050942
LinkDB All DBs
Position
5
AA seq 1234 aa AA seqDB search
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDSNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNKQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGIPLPSPQDLMGRILVKNKKRHRLGSGVPDS
SVRKRPLEQSNSALSESSATTEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPRKSLGE
EGLQRGPDALGPAYREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVPMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANAVRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQSGPETSQETQTQQL
GYQLNPHPTPSPLDASPRRPPGPATSPTSSSISSSISSPGQRDDLIASILSEVAPAPLDE
LRGHKALVKLRSRQERDFRELYKKHQRKAVALTRRLLDNLAQARAGSRCRQRPGVLSGED
ERAEEEEVSRYQEFQKKQVQCLLELREAQVDTEAERRLEHLQQAQLKLREVVLDAHMTQL
KKLKEINEREKKELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLE
EAQKQRQERLVAGQQQILQQLAEEEPKLLAQLVQECQEQRERLPQEIRWSLLGETQEGLG
DGHLVACASNGHAPGSSGHLPGADSESQEETTKL
NT seq 3705 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccaggcccggcgtccacgcgctgcagctggagccgcccaccgtcgtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggaggcctccagtcggaacctg
gtaaccctgcgagtggactccaatggcttcttcctgtactggacaggacccaacatggag
gtggacacactcgacatcagctccatcagggacaccaggacgggccgttatgcccgcctg
cccaaggaccccaagatccgggaggtgttgggctttgggggccctgatgcccggttggag
gagaagctgatgacagttgtggccgggccagacccggtgaatacaacattcttgaacttc
atggccgtgcaggatgatacagccaaggtctggtccgaggagctcttcaagttggctatg
aacatcctggctcagaacgcctcccggaacaccttcttgcgcaaagcatacacgaagctg
aagctgcaggtaaaccaggatggacggattccagtcaagaacatcctgaagatgttctca
gcagacaagaagcgggtagaaactgcactggaatcctgtggcctcaatttcaaccgaagc
gagtccatccggcctgacgagttttccttggaaatctttgagcggttcctgaacaagctg
tgtctgcggccggacattgacaagatcctgctggagataggcgccaagggcaaaccttac
ctgacactggagcagctcatggatttcattaaccagaagcagcgggacccgcggctcaac
gaagtgctgtacccacctctgcggccctcccaggcccggctgctcatcgagaagtacgag
cccaacaagcagttcctggagcgagaccagatgtccatggagggcttcagccgctacctg
ggaggtgaggagaatggcattctgccgcttgaggccttggatctgagcgcagacatgacc
cagccactcagcgcctacttcatcaattcctcacacaacacctatctcacggcggggcag
ctggccggaacctcgtcggtggagatgtaccggcaggcgctgttgtggggctgccgctgt
gtggagctggacgtgtggaaggggcggccgcccgaggaggagccgttcatcacgcacggc
ttcaccatgaccacggaggtgccgctgagagacgtgctcgaggccatcgcggagaccgcc
ttcaagacttcaccctaccccgtcatcctctcctttgagaaccacgtggactcggcgaaa
cagcaggccaagatggctgagtactgccgctccatctttggggacgctctgctcattgac
cccctggacaagtacccgctggccccaggcatacccctgcccagcccccaggacctgatg
ggccgcatcctggtgaagaacaagaagcggcaccgactcggcagcggcgtccctgacagc
tccgtgcgcaagcggccactcgagcagagcaactcggccctgagcgagagctccgccacc
accgagccctcctcgccccagcttgggtcccccagctctgacagctgcccaggcctgagc
aatggggaggaggtgggcctcgagaagcccagcctggagcctcggaagtctctgggggag
gaaggtttgcagcggggccctgatgctcttggacctgcctaccgggaggatgaggaagag
gacgaggaagaggaggaacaaacggaccccaaaaagccgaccacggatgagggcactgcc
agcagtgaggtcaacgccaccgaggaaatgtccacactcgtcaactatatcgaacctgtc
aagttcaagtccttcgaggctgctcgaaagaggaacaagtgcttcgagatgtcgtccttc
gtggagaccaaggccatggagcaactgaccaagagccccatggagtttgtggaatacaac
aagcagcagctcagccgcatctaccccaagggcacccgcgtggactcgtccaactacatg
ccccagctcttctggaatgtgggctgccagctcgttgcactcaactttcagactctagat
gtgccgatgcagctcaacgccggcgtgtttgagtacaacgggcgcagcggctacctactc
aagcctgagttcatgcggcggccagacaagtcctttgaccccttcaccgaagtcatagtg
gacggcatcgtggccaatgccgtgcgggtcaaggtgatctcggggcagttcctgtccgac
aggaaggtgggcatctacgtggaggtggacatgttcgggcttcctgttgacacgcggcgc
aagtaccgcacgcggacctcacaagggaactcgttcaaccctgtgtgggatgaggagcca
ttcgacttccccaaggtggtgctgcccacgctggcttcgctgcgcatcgcagcctttgag
gaggggggcaagttcgtggggcaccggatcctgcctgtctctgccatccgctcagggtac
cattacatctgcctgcggaacgaggccaaccagccgctgtgcctgccagccctgctcatc
tacaccgaggcctccgactacatccccgacgaccaccaggactatgcagaggccctgatc
aaccccatcaagcatgtcagcctgatggaccagagggccaagcagctggctgccctcatt
ggggagagcgaggctcagtctggcccagagacgagccaggagacccagactcagcagctg
gggtaccagctgaacccacacccaacgcccagcccactggacgcctccccgcgccggccc
ccaggccccgccacctccccgaccagctcctccatcagctcctccatcagcagcccaggt
cagcgcgatgatctcatcgccagcatcctctcagaggtggccccggccccgctggacgag
ctccgaggccacaaggccctggtgaagctccggagccggcaagagcgagacttccgggag
ctgtacaagaaacatcagcggaaggccgttgccctcacgcgccggttgctcgacaacctg
gcccaggcccgtgcggggagcaggtgccgacagcggcctggtgtcctaagcggggaggac
gagagggcagaagaggaagaagttagcaggtatcaagagttccagaagaaacaggtgcag
tgtctgctggagctgagggaggcccaggtggacacagaggcggagcggaggctggagcac
ctgcagcaggctcagctgaagctcagggaggttgtcctggatgctcacatgactcagttg
aagaaactgaaggagataaacgagagggagaagaaggaactgcagaagatcctggacagg
aaacgccacaacagtatctcagaggccaagaccagggagaaacataagaaggaggcggaa
ctaacagagattaaccgtcggcacatcactgagtcagtcaactccatccgtcggctggag
gaggcccagaagcagcggcaggaacgccttgtggccggacagcagcagatcctccaacag
ctggcggaagaggagcccaagctgctggcccagctggtccaggagtgtcaggagcagcgg
gagaggctgccccaggagatccgctggagcctgctgggcgagacacaggagggactgggg
gacgggcatctggtcgcctgtgccagcaacggtcacgcgcctgggagcagtgggcacctg
cccggcgctgactcagagagccaggaggagactacaaagctctga

DBGET integrated database retrieval system