KEGG   Bubalus bubalis (water buffalo): 102413882
Entry
102413882         CDS       T05912                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3 precursor
  KO
K04736  interleukin 3
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04060  Cytokine-cytokine receptor interaction
bbub04151  PI3K-Akt signaling pathway
bbub04210  Apoptosis
bbub04630  JAK-STAT signaling pathway
bbub04640  Hematopoietic cell lineage
bbub04664  Fc epsilon RI signaling pathway
bbub05200  Pathways in cancer
bbub05202  Transcriptional misregulation in cancer
bbub05221  Acute myeloid leukemia
bbub05310  Asthma
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102413882 (IL3)
   04151 PI3K-Akt signaling pathway
    102413882 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102413882 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102413882 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102413882 (IL3)
   04664 Fc epsilon RI signaling pathway
    102413882 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102413882 (IL3)
   05202 Transcriptional misregulation in cancer
    102413882 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102413882 (IL3)
  09163 Immune disease
   05310 Asthma
    102413882 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bbub04052]
    102413882 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:bbub00536]
    102413882 (IL3)
Cytokines and growth factors [BR:bbub04052]
 Cytokines
  Interleukins
   102413882 (IL3)
Glycosaminoglycan binding proteins [BR:bbub00536]
 Heparan sulfate / Haparin
  Cytokines
   102413882 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 102413882
NCBI-ProteinID: NP_001277800
UniProt: Q6Q8A8
LinkDB
Position
9
AA seq 144 aa
MSSLSISHLLLLLLALHAPQAKGLPVMTSRAPYSMLMREIMDDLKKITPSPEGSLNSDEK
NFLTKESLLQANLKAFMTFATDTFGKDSKIMKNLKEFQPVLPTATPTEDPISIENKNLGD
FRMKLEEYLVNIRKYLKSKNLWFS
NT seq 435 nt   +upstreamnt  +downstreamnt
atgagcagtctctccatctcgcacctgcttctgctcctgcttgcgctccatgcccctcag
gcaaaggggttgcctgtcatgacatcgagggctccatattctatgttgatgagggaaatt
atggatgacctaaagaaaataactccgagtccagaaggctccttgaactcagatgagaag
aatttcctgacgaaagagagccttctgcaggcaaacctgaaagcattcatgacatttgcc
acagatacttttggaaaggattcaaaaatcatgaaaaatcttaaggaattccagccagtg
ctgcccacagccacacccacggaagatccaatttctattgagaacaagaacttgggtgat
ttccggatgaagttggaagaatatttggttaacattagaaaatatctgaagtccaagaac
ttatggttttcctaa

DBGET integrated database retrieval system