KEGG   Bubalus bubalis (water buffalo): 102414298
Entry
102414298         CDS       T05912                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub01524  Platinum drug resistance
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04022  cGMP-PKG signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04140  Autophagy - animal
bbub04151  PI3K-Akt signaling pathway
bbub04210  Apoptosis
bbub04370  VEGF signaling pathway
bbub04510  Focal adhesion
bbub04722  Neurotrophin signaling pathway
bbub04910  Insulin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub05010  Alzheimer disease
bbub05014  Amyotrophic lateral sclerosis
bbub05020  Prion disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05145  Toxoplasmosis
bbub05152  Tuberculosis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05165  Human papillomavirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05223  Non-small cell lung cancer
bbub05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102414298 (BAD)
   04014 Ras signaling pathway
    102414298 (BAD)
   04370 VEGF signaling pathway
    102414298 (BAD)
   04024 cAMP signaling pathway
    102414298 (BAD)
   04022 cGMP-PKG signaling pathway
    102414298 (BAD)
   04151 PI3K-Akt signaling pathway
    102414298 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102414298 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    102414298 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102414298 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102414298 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102414298 (BAD)
   04919 Thyroid hormone signaling pathway
    102414298 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102414298 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102414298 (BAD)
   05203 Viral carcinogenesis
    102414298 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102414298 (BAD)
   05212 Pancreatic cancer
    102414298 (BAD)
   05225 Hepatocellular carcinoma
    102414298 (BAD)
   05221 Acute myeloid leukemia
    102414298 (BAD)
   05220 Chronic myeloid leukemia
    102414298 (BAD)
   05218 Melanoma
    102414298 (BAD)
   05211 Renal cell carcinoma
    102414298 (BAD)
   05215 Prostate cancer
    102414298 (BAD)
   05213 Endometrial cancer
    102414298 (BAD)
   05223 Non-small cell lung cancer
    102414298 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102414298 (BAD)
   05014 Amyotrophic lateral sclerosis
    102414298 (BAD)
   05020 Prion disease
    102414298 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    102414298 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102414298 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102414298 (BAD)
   05161 Hepatitis B
    102414298 (BAD)
   05160 Hepatitis C
    102414298 (BAD)
   05162 Measles
    102414298 (BAD)
   05168 Herpes simplex virus 1 infection
    102414298 (BAD)
   05165 Human papillomavirus infection
    102414298 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102414298 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102414298 (BAD)
   01524 Platinum drug resistance
    102414298 (BAD)
   01522 Endocrine resistance
    102414298 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 102414298
NCBI-ProteinID: XP_006050944
LinkDB
Position
5
AA seq 168 aa
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSH
HGGTGAVETRSRHSSYPAGPEDNEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSD
EFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcagagtgagcaggaagactccagccctgcagatagg
ggcctgggccccagccccacaggggacaggcccccaggtctcagcaagcactggctaaca
gccccaggcctcctgggggaagctggtcaccagcaggggcagccggccggcagcagccac
catggaggcactggggctgtggagacccggagtcgtcacagctcctaccccgcggggcca
gaggataatgaagggacggaagaggaggatctcggcccctttaggggccgctcgcgttcg
gcgccccccaacctctgggctgcacagcgatatggccgcgagctccggaggatgagcgac
gagtttcacgtctccttcaaggggcttcctcgcccgaagagcgcgggcacggcaacgcaa
atgcgacaaagccccagctggacgcgcttcctccagtcctggttgagccggaacttgggg
agaggaggctccgccccctcccagtga

DBGET integrated database retrieval system