Bubalus bubalis (water buffalo): 102414313 Help Entry 102414313         CDS       T05912                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04146   Peroxisome bbub04213   Longevity regulating pathway - multiple species bbub05012   Parkinson disease bbub05014   Amyotrophic lateral sclerosis bbub05016   Huntington disease bbub05020   Prion disease bbub05022   Pathways of neurodegeneration - multiple diseases bbub05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:bbub00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     102414313 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     102414313 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     102414313 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     102414313 (SOD1)    05014 Amyotrophic lateral sclerosis     102414313 (SOD1)    05016 Huntington disease     102414313 (SOD1)    05020 Prion disease     102414313 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     102414313 (SOD1) Enzymes [BR:bbub01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      102414313 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  102414313 NCBI-ProteinID:  NP_001277902 EnsemblRapid:  ENSBBUG00015007320 UniProt:  J9QN81 LinkDB All DBs Position 1:complement(49063410..49071704) Genome browser AA seq 152 aa AA seqDB search MATKAICVLKGDGPVQGTIHFEAKGNTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAG PHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDSLISLSGEYSIIGRTMVVHE KPDDLGRGGNDESTKTGNAGSRLACGVIGIAK NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcgacgaaggccatctgcgtgctgaagggcgacggcccggtgcaaggcaccatccac ttcgaggcaaagggaaatacagtcgtggtaactggatccattacaggattgaccgaaggt gatcatggattccacgtccatcagtttggagacaatacacaaggctgtaccagtgcaggt cctcactttaatcctctgtccaaaaaacacggtgggccaaaagatgaagagaggcatgtt ggagacctgggcaatgtgacggctgacaaaaacggtgttgccatcgtggatattgtcgat tctctgatctcactctcaggagaatattccatcattggccgcacgatggtggtccatgaa aaaccagatgacttgggcagaggtggaaatgacgaaagtacaaagactggaaacgctgga agtcgtttggcctgtggtgtaattggaattgccaagtaa

DBGET integrated database retrieval system