KEGG   Bubalus bubalis (water buffalo): 102414888
Entry
102414888         CDS       T05912                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X2
  KO
K04692  signal transducer and activator of transcription 3
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub04062  Chemokine signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04217  Necroptosis
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04630  JAK-STAT signaling pathway
bbub04659  Th17 cell differentiation
bbub04917  Prolactin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04931  Insulin resistance
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub05145  Toxoplasmosis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05169  Epstein-Barr virus infection
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05212  Pancreatic cancer
bbub05221  Acute myeloid leukemia
bbub05223  Non-small cell lung cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bbub05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102414888 (STAT3)
   04066 HIF-1 signaling pathway
    102414888 (STAT3)
   04068 FoxO signaling pathway
    102414888 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102414888 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102414888 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102414888 (STAT3)
   04062 Chemokine signaling pathway
    102414888 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102414888 (STAT3)
   04917 Prolactin signaling pathway
    102414888 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    102414888 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102414888 (STAT3)
   05206 MicroRNAs in cancer
    102414888 (STAT3)
   05205 Proteoglycans in cancer
    102414888 (STAT3)
   05203 Viral carcinogenesis
    102414888 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102414888 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102414888 (STAT3)
   05221 Acute myeloid leukemia
    102414888 (STAT3)
   05223 Non-small cell lung cancer
    102414888 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102414888 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102414888 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102414888 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    102414888 (STAT3)
   05161 Hepatitis B
    102414888 (STAT3)
   05160 Hepatitis C
    102414888 (STAT3)
   05163 Human cytomegalovirus infection
    102414888 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102414888 (STAT3)
   05169 Epstein-Barr virus infection
    102414888 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102414888 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102414888 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbub03000]
    102414888 (STAT3)
Transcription factors [BR:bbub03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102414888 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 102414888
NCBI-ProteinID: XP_006055812
LinkDB
Position
3
AA seq 769 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNT
IDLPMSPRTLDSLMQFGNNGEAAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2310 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctccagcagctggacacacggtacttggagcagctccatcag
ctgtacagtgacagcttccccatggagctgcggcagtttctggccccttggatcgagagt
caagattgggcatatgcggccagcaaagaatcacatgcgactttagtgtttcataatctc
ttgggagaaattgaccaacagtatagccgcttcctgcaagagtccaatgttctctatcag
cacaatttgcgaagaatcaagcagttccttcagagcagataccttgagaagccaatggag
attgcccgaattgtggcccgttgcctgtgggaggagtcccgcctcctccaaactgcagcc
actgcagcccagcaagggggccaggccaaccaccccacagccgccgtggtaacggagaag
cagcagatgctggagcagcacctgcaggacgtccgcaagcgtgtccaggatctagaacag
aagatgaaagtggtagagaatctccaggatgatttcgatttcaactataaaactctcaag
agtcaaggagacatgcaagatctgaatggaaacaaccagtcggtgaccaggcagaagatg
cagcagctcgaacagatgcttactgccctggaccagatgcggcgcagcatcgtgagtgag
ctggcggggcttttgtcagcgatggagtatgtgcagaaaactctcacggatgaagaattg
gctgactggaagaggcgacaacagattgcttgcattggaggccctcccaacatctgccta
gatcggctagaaaactggataacctcattagcagaatctcagcttcagacccgccaacaa
attaagaaactggaggagctgcagcagaaggttagctacaaaggggaccccattgtacaa
caccggccaatgctggaggagagaatcgtggagctgtttagaaacttaatgaaaagtgcc
ttcgtggtggagcggcagccctgcatgcctatgcatcctgaccggccattagtcatcaag
accggtgtccagttcacaactaaagtcagattgctggttaaattccctgagctaaattat
caacttaaaattaaagtgtgcattgacaaagactccggggacgttgcagctctcagaggg
tcccggaaatttaacattctgggcacaaacacgaaagtgatgaacatggaagagtctaac
aatggcagcctctcagcggagttcaaacacttgaccctgagagagcagagatgcggtaat
gggggccgagccaattgtgatgcctccctgattgtgaccgaggagctgcacctgatcacc
tttgagactgaggtgtatcaccaaggcctcaagattgacctggagacccactccttgcca
gtggtggtgatctccaacatctgtcagatgcccaatgcctgggcatccatcctatggtac
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaaacccccaatcggaacg
tgggatcaagtggccgaggtgctgagctggcagttctcctctaccaccaagcgcgggctg
agcatcgagcagttgacgacgctggcggagaaactcttaggacctggtgtgaactattca
gggtgtcagatcacatgggctaaattttgcaaagaaaacatggctggcaagggcttctcc
ttctgggtctggctggacaacatcattgacctggtgaaaaagtacatcctagccctttgg
aacgaagggtatataatgggcttcatcagcaaggagagggaacgggccatcttgagcact
aagcccccaggcaccttcctgctgagattcagtgaaagcagcaaagaaggaggagtcacc
ttcacctgggtggagaaggacatcagtggcaagacccagatccagtcagtggaaccttac
accaagcagcagctgaacaacatgtcatttgctgaaatcatcatgggctataagatcatg
gatgccaccaatatcctggtgtctccgctggtctatctctaccccgacattccaaaggag
gaggcgttcggaaagtactgtcggccggagagccaggagcatcccgaagctgacccaggc
gctgccccgtacctgaagaccaagttcatctgtgtgacaccaacgacctgcagcaatacc
attgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataatggt
gaagctgctgaaccctcagcaggagggcagtttgagtccctcacgttcgacatggagctg
acctcggagtgcgctacctcccccatgtga

DBGET integrated database retrieval system