KEGG   Bubalus bubalis (water buffalo): 102414912
Entry
102414912         CDS       T05912                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interferon-inducible protein AIM2-like
  KO
K12966  absent in melanoma 2
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04621  NOD-like receptor signaling pathway
bbub04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102414912
   04623 Cytosolic DNA-sensing pathway
    102414912
SSDB
Motif
Pfam: HIN
Other DBs
NCBI-GeneID: 102414912
NCBI-ProteinID: XP_025143176
LinkDB
Position
6
AA seq 207 aa
MGVAVVQGISEGWYDALPKKGKQEMCHAAVSTESEFFFVKVFSKKLKDKFTPSKIIMISK
YYWHSCFLEVMLISLVCDTEFDQIHVSKHIIRKDGDTLRSINFNFSPREQLVNGLFVLLP
PIPPSIRVFSNESTLCDLNESTGRIEVLMLGNEKKIQCKEWNKLQFIFLELSKTGEKLYL
KSRIHSFINREAKWTGAIEQNVEDPNI
NT seq 624 nt   +upstreamnt  +downstreamnt
atgggggtggctgtggtacagggaatctccgaagggtggtatgatgccttgcccaagaaa
gggaagcaggagatgtgtcatgctgcagtgtctactgagagtgaattcttttttgtgaaa
gttttcagtaagaagctcaaggataaattcactccaagcaaaataatcatgatatcaaaa
tattattggcacagttgtttcctggaagtgatgctgatttccctggtgtgtgacactgaa
tttgaccagatccatgtctcaaagcatattatcagaaaagatggtgataccctaaggtca
ataaacttcaatttcagccccagagaacaacttgtgaatgggctgtttgtactcctgccc
ccaatccctcccagcatcagagtcttttccaatgagtcaactctatgtgacctaaatgag
agcacaggaagaatagaagtattgatgcttggaaacgagaagaaaatccagtgcaaggaa
tggaataaacttcaatttatattcttagagctatcaaagactggagaaaaactatacctg
aaatctagaattcatagtttcattaacagagaagctaaatggacaggtgctattgaacag
aacgtggaagaccctaatatttag

DBGET integrated database retrieval system