KEGG   Bubalus bubalis (water buffalo): 102415293Help
Entry
102415293         CDS       T05912                                 

Definition
(RefSeq) cholesterol 7-alpha-monooxygenase
  KO
K00489  cholesterol 7alpha-monooxygenase [EC:1.14.14.23]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00120  Primary bile acid biosynthesis
bbub00140  Steroid hormone biosynthesis
bbub01100  Metabolic pathways
bbub03320  PPAR signaling pathway
bbub04976  Bile secretion
bbub04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    102415293
   00140 Steroid hormone biosynthesis
    102415293
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102415293
  09154 Digestive system
   04976 Bile secretion
    102415293
   04979 Cholesterol metabolism
    102415293
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bbub00199]
    102415293
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.23  cholesterol 7alpha-monooxygenase
     102415293
Cytochrome P450 [BR:bbub00199]
 Cytochrome P450, animal type
  CYP7 family
   102415293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 MIG-14_Wnt-bd
Motif
Other DBs
NCBI-GeneID: 102415293
NCBI-ProteinID: XP_006045714
LinkDB All DBs
Position
15
AA seq 500 aa AA seqDB search
MMSLSLIWGIVIAVCCCLYLLGMRRRQMGEPPLENGLIPYLGCALQFGANPLEFLRANQR
KHGHVFTCRLMGNYVHFITNPLSYHKVLCHGKYFDWKKFHFTASAKAFGHRSIDPSDGNT
TDTISKTIIKTLQGDALSSLTEAMMGNLQLVLRPQGPPQPPTPTWVTEGMYSFCYRVMFE
AGYLTLFGRDLAGQDAQKALILNSLDNFKQFDKIFPALVAGFPIHVFKTGHYAREKLTEG
LRLQKLRERDHISELVRFLNDTFATLDDTERAKSLLAVLWASQANTIPATFWSLFQMIRN
PEAMKAATEEVNKTLENAGQKVSFEDNPIHLNQTQLDNMPMLDSIIKESLRLSSASLNIR
TAKEDFTLHLQDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTFY
SNGLKLKYYYMPFGSGVTICPGRLFAVQEIKQFLILMLSYFELELVESCVKCPPLDQSRA
GLGILPPLYDIEFRYKFKHS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcctctctttgatttgggggattgttatagcagtgtgctgttgtttataccta
cttggaatgagaagaaggcagatgggcgaaccacctctggagaatgggctgattccgtat
ctgggttgtgctctgcagtttggtgccaatcctctcgagttcctcagagcgaatcaaagg
aaacatggtcatgttttcacctgcagactgatgggcaactatgttcacttcatcacaaat
cccttgtcatatcataaagtactgtgccatggaaaatactttgattggaaaaaatttcac
tttactgcttctgcaaaggcatttggacacagaagcattgacccgagtgatggaaacacc
actgataccataagcaaaactatcatcaagaccctgcagggtgacgccttgagctccctc
acggaagccatgatgggaaacctccagcttgtcctgagaccccaggggccaccacagccc
cccacacccacctgggtgaccgaggggatgtactccttctgctatcgggtcatgttcgaa
gctggctacttgacgctctttggccgcgatctcgcagggcaagatgcccaaaaggcgctc
attctaaacagcctggacaacttcaagcaatttgacaaaatctttcctgccctggtggct
ggcttccccatccatgtgttcaagacaggacactacgcccgggagaagctgacagagggc
ttgagactccagaagctcagagaaagagaccacatctcagaactggtcagatttctgaat
gacacattcgccaccttggacgacacagagagagccaagtcactcctcgcagtcctctgg
gcatcgcaagcaaacaccattccagccactttctggagcttgtttcaaatgattagaaac
ccggaggcaatgaaagcggccactgaagaagtaaataaaacactagagaacgctggtcaa
aaagttagctttgaagacaatccaattcatttgaatcagacacagttggacaacatgcct
atgctagacagtatcatcaaggagtctctgagactttccagcgcttccctcaacatccgt
actgctaaagaggacttcactttgcacctccaagacggttcctataatatccgcaaagat
gacatcatagctctttatccacagttaatgcatttagatccagaaatctacccagacccg
ttgacttttaaatacgatcgctatcttgatgaaaatgggaagacaaagaccaccttctac
agtaatggactcaagttaaaatattactacatgccctttgggtcaggagtcactatatgt
cctggaagattattcgctgtccaggaaatcaagcagtttttgatcctgatgctttcctat
ttcgaactggagcttgtggagagctgtgtcaaatgcccacctttggaccaatcccgggca
ggcttgggcattttaccaccattatatgatattgagtttagatataaattcaagcattcg
tga

DBGET integrated database retrieval system