KEGG   Bubalus bubalis (water buffalo): 102415303
Entry
102415303         CDS       T05912                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2 isoform X2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04010  MAPK signaling pathway
bbub04060  Cytokine-cytokine receptor interaction
bbub04068  FoxO signaling pathway
bbub04144  Endocytosis
bbub04218  Cellular senescence
bbub04350  TGF-beta signaling pathway
bbub04380  Osteoclast differentiation
bbub04390  Hippo signaling pathway
bbub04520  Adherens junction
bbub04659  Th17 cell differentiation
bbub04926  Relaxin signaling pathway
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub05142  Chagas disease
bbub05161  Hepatitis B
bbub05166  Human T-cell leukemia virus 1 infection
bbub05200  Pathways in cancer
bbub05202  Transcriptional misregulation in cancer
bbub05210  Colorectal cancer
bbub05212  Pancreatic cancer
bbub05220  Chronic myeloid leukemia
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102415303 (TGFBR2)
   04350 TGF-beta signaling pathway
    102415303 (TGFBR2)
   04390 Hippo signaling pathway
    102415303 (TGFBR2)
   04068 FoxO signaling pathway
    102415303 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102415303 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102415303 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    102415303 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102415303 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102415303 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102415303 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102415303 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102415303 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    102415303 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102415303 (TGFBR2)
   05212 Pancreatic cancer
    102415303 (TGFBR2)
   05225 Hepatocellular carcinoma
    102415303 (TGFBR2)
   05226 Gastric cancer
    102415303 (TGFBR2)
   05220 Chronic myeloid leukemia
    102415303 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102415303 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102415303 (TGFBR2)
   05161 Hepatitis B
    102415303 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102415303 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102415303 (TGFBR2)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102415303 (TGFBR2)
Protein kinases [BR:bbub01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102415303 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 102415303
NCBI-ProteinID: XP_006046923
LinkDB
Position
21
AA seq 567 aa
MGRGLLGGLWPLHVVLWTRIASTIPPHVPKSVNSDVMVTDHNGAIKLSQLCKFCDVRSST
CDNQKSCWSNCSITAICEKPEEVCVAVWRKNDENITLETVCHDPKIAYHGFVLDDAASSK
CIMKERKGSGETFFMCSCSSEECNDHIIFSEEYTSSNPDLLLVIFQVTGVSLLPPLGIAI
AVIVTFYCYRIHRQQKLSPAWDSGKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRRLGGSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKGDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQTVCETLAECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSSSEEKIPEDGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggccgggggctgctcgggggcctgtggccgctgcacgtcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcccaagtcggttaacagcgacgtgatggtcactgac
cacaacggcgccatcaagctgtcacagctgtgtaagttctgcgacgtgcgatcgtccacc
tgtgacaaccagaagtcctgctggagcaactgcagcatcacggctatctgcgagaagccg
gaggaggtctgcgtggctgtctggaggaagaatgatgagaacatcacgctggagacagtc
tgccatgaccccaagattgcctaccatggatttgtcctggacgatgctgcttcttcaaag
tgtatcatgaaggaaagaaaggggtctggagagactttcttcatgtgctcctgcagctcc
gaagagtgcaatgaccacatcatcttctccgaagagtacaccagcagtaaccccgacttg
ctgctggtcatcttccaagtgacaggcgtcagcctcctgccgccgctgggcatcgccatc
gccgtcatcgtcactttctactgctaccgcatccaccggcagcagaagctgagcccggcc
tgggactcgggcaagccgcgcaagctgatggagttcagcgagcacctggccatcatcctg
gaggacgaccgctccgacatcagctccacctgcgccaacaacatcaaccacaacacggag
ctgctgcccattgagctggacaccctggtgggcaaggggcgcttcgccgaggtctacaag
gccaagctgaagcagaacacgtctgagcagttcgagaccgtggccgtcaagatcttcccc
tacgaggagtatgcctcctggaagacggagaaggacatcttctcggacatcaacctcaag
cacgagaacatcctgcagttcctgacggcggaggagcgcaagacggagctgggcaagcag
tactggctcatcactgccttccacgccaagggcaacctgcaggagtacctgacgcgccat
gtcatcagctgggaggacctgcgccggctgggcggctcgctggcccgcggcatcgcgcac
ctgcatagcgaccacaccctgtgcggccggcccaagatgcccatcgtgcacagggacctc
aagagctccaacatcctggtcaagggcgacctcacctgctgcctctgtgacttcgggctc
tcactgcggctggaccccaccctgtcggtggatgacctggccaacagtgggcaggtggga
acggcgagatacatggctccagaggtcctcgagtccaggatgaatctggagaacgtggag
tccttcaagcagacggatgtctactccatggccctggtgctctgggagatgacgtctcgc
tgcaacgcagtgggagaagtgaaggactatgagcctccgttcgggtctaaggtgcgggag
catccctgtgtggaaagcatgaaggacaatgtgctgagagatcgaggccgaccagagatt
cccagctcctggctcaaccaccagggcatccagacggtgtgcgagacgctggccgagtgc
tgggaccacgaccccgaggcccggctcacagcgcagtgcgtggccgagcgcttcagcgag
ctggagcacctggacaggctctccgggaggagcagctcggaggagaagatccccgaagac
ggctccctcaacactaccaaatag

DBGET integrated database retrieval system