KEGG   Bubalus bubalis (water buffalo): 102415495Help
Entry
102415495         CDS       T05912                                 

Gene name
AQP7
Definition
(RefSeq) aquaporin-7 isoform X1
  KO
K08771  aquaporin-7
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub03320  PPAR signaling pathway
bbub04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    102415495 (AQP7)
   03320 PPAR signaling pathway
    102415495 (AQP7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbub02000]
    102415495 (AQP7)
Transporters [BR:bbub02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    102415495 (AQP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 102415495
NCBI-ProteinID: XP_006066760
LinkDB All DBs
Position
3
AA seq 330 aa AA seqDB search
MTQSDRKRRSTRVSKVVSTPTATKMQVIWQNENVREFLAEFISTYVMMVFGLGAVAHMVL
GGKLGSYLAVNLGFGFGVTIGVHMAGNISGAHMNAALTFTSCALGRMSWKKFPVYVLGQF
LGSFVAAATIYGLFYNAIIDFSGGKLMTTGPTATANIFATYLPDHMTLWRGFLDEVVVTG
MLQLCLLAIADKGNNPTLLGTQAIVTGILVVIIGISLGMNSGYAINPSRDLPPRFFTFLA
GWGSQVFRTKDWWWVPVVAPPLGAYCGAIIYLFFIGSNKRQEPQVLENPLTLEDHRISVL
PKTTSHQPGVASLTPVSVYPEDRPSVLYHP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgactcagtcagacaggaagaggcggtccacccgtgtgtccaaggtggtctcgacacct
acagcaacaaagatgcaagtcatatggcagaacgagaatgttcgagagttcctggcggag
ttcatcagcacgtatgtcatgatggtgttcggtctcggcgctgtggcccacatggttcta
ggaggtaaactggggagctacctcgctgtcaatttgggttttggcttcggagtcaccata
ggtgtgcacatggcggggaacatctctggggcccacatgaatgcggccttgaccttcacc
agctgtgcactaggccgcatgtcctggaagaagtttcccgtgtatgttctgggtcagttc
ctgggctccttcgtggcggcggccaccatctacggcctcttctacaacgctattatcgac
ttctcggggggaaagctgatgacgaccggccccacagccactgctaacatttttgccacc
taccttcctgaccacatgacactgtggaggggcttcctggatgaggtggtggtgactggg
atgcttcagctgtgtctcttagccatcgcagacaaggggaacaacccaacgctgttgggg
acgcaggccattgtgactggcatccttgttgtcatcatcggaatatccctgggcatgaac
tcaggatatgccatcaacccatcccgggacctgcctccccgcttcttcaccttcctcgct
ggctggggctcacaagtcttcagaaccaaggactggtggtgggtgccggtggtggcacca
cccctgggtgcctactgtggtgccatcatctacttgttcttcattggctccaacaaacga
caggagccccaggtcctggagaatcccttgacgcttgaagaccacagaatatctgtgttg
cccaagaccacatctcaccagcctggggtcgcttccctcacccctgtttccgtgtacccc
gaagatagaccctcagtcttgtaccacccttaa

DBGET integrated database retrieval system