KEGG   Bubalus bubalis (water buffalo): 102416325
Entry
102416325         CDS       T05912                                 

Gene name
EGF
Definition
(RefSeq) LOW QUALITY PROTEIN: pro-epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04020  Calcium signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04510  Focal adhesion
bbub04540  Gap junction
bbub04630  JAK-STAT signaling pathway
bbub04810  Regulation of actin cytoskeleton
bbub05160  Hepatitis C
bbub05165  Human papillomavirus infection
bbub05200  Pathways in cancer
bbub05210  Colorectal cancer
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05226  Gastric cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102416325 (EGF)
   04012 ErbB signaling pathway
    102416325 (EGF)
   04014 Ras signaling pathway
    102416325 (EGF)
   04015 Rap1 signaling pathway
    102416325 (EGF)
   04630 JAK-STAT signaling pathway
    102416325 (EGF)
   04066 HIF-1 signaling pathway
    102416325 (EGF)
   04068 FoxO signaling pathway
    102416325 (EGF)
   04020 Calcium signaling pathway
    102416325 (EGF)
   04072 Phospholipase D signaling pathway
    102416325 (EGF)
   04151 PI3K-Akt signaling pathway
    102416325 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102416325 (EGF)
   04540 Gap junction
    102416325 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102416325 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102416325 (EGF)
   05231 Choline metabolism in cancer
    102416325 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102416325 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102416325 (EGF)
   05212 Pancreatic cancer
    102416325 (EGF)
   05226 Gastric cancer
    102416325 (EGF)
   05214 Glioma
    102416325 (EGF)
   05218 Melanoma
    102416325 (EGF)
   05219 Bladder cancer
    102416325 (EGF)
   05215 Prostate cancer
    102416325 (EGF)
   05213 Endometrial cancer
    102416325 (EGF)
   05224 Breast cancer
    102416325 (EGF)
   05223 Non-small cell lung cancer
    102416325 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102416325 (EGF)
   05165 Human papillomavirus infection
    102416325 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102416325 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bbub04052]
    102416325 (EGF)
Cytokines and growth factors [BR:bbub04052]
 Growth factors
  Growth factors (RTK binding)
   102416325 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF EGF_CA DUF5050 EGF_3 hEGF
Other DBs
NCBI-GeneID: 102416325
NCBI-ProteinID: XP_025146089
LinkDB
Position
7
AA seq 1232 aa
MLHLLVIVLLVVFKFSFVSLSALQHWNCPEGSPSGNGNSTCLVPFLIFSHGNSICRIDLE
GTNYEQLVADAGISVIMDFHYNEERIYWVDLQRXLLQRVHLNGRRQEKAYDIDKNVSGMA
INWINEELIWSNQQEGIITVTDMKGNNSWVLLSALKYPANIAVDQFMFWSSEVAXSLHRA
DLGGMEVKLLLETSETITAVSLDMLDKRLFWIQYHRGGGDPRICSCDYDGGSVLRHIXQI
FSKYSLRHNLLAASFFGDCIFYSTWKKKTIWIANKHTGKDMVKITLNSLFVPXSGIKVVR
PLVQPKAEGDAWASDQKLCKLKKGNCSGSMCEQXPKSQVCTCAEGYTLSQDGKNCEGNLM
SVGKYAFRNHGYTDDCENIPGSYYCTCPEGYVLLPDGKWCHXLISCPSNMSECSQDCVLT
SDGPICSCPEGSVLDTDGKNAELLFVGCSSPDNGGCSQLCTPLSPVSWKCGCLPGYDLQL
DKKSCRPSGPPPFLLFANSQDIRYMHFDGTDYGTLVHQQIGMVFTLDHDPVENKTVCLCS
FSLIYFAHTVLKWIERANMDASQRXRLIEEEVGLPEGLAVDWIGHKLYWTDRGKSLIEGS
DLNGKYCEIIIKEGIFQPRGXAVHPMAKRLFWTDMGINPXIESSSLQGSGRLVIASSDLV
WPSGIAVDYLPDKLYWCDAKQSVIEMSNLDGSKCXRLSQKDVGHSFAVAVFEDHVWFSDW
TMPSIIRMNKRTGKNSIRLPGSMLKPSSLVVVHPLAKPGADPCLHQNGXCEHICKERFET
AQCLCHEGFVKAPDGKMCLALDGHRILADHMTNGSGANLNSEVLPLDVLAGSRELDYNMA
ESQHLPVAEMMVSGLNQDTDAMGCGTRAECLSEGADVTCQCLKGFAGDGKQCSDKNGREM
GLSVCPPTSPKCVNTEGGYVCRHSEGYXGDGIHCLDIDEHRRGVHSCGENATXTNMEENH
TCTRAGGLSEPGQICPDSTLLSHLGKNGHNFLKNCFPECSLNFEGYCLNGGVCIYFGIDN
LFSCHCPVGYAGKRCEYADFDGWDPHCAGRGHQWNVSPVAVRVLVLAFLLLPGLCRAHYY
YRTQKWLLKNPKNPCEELSGDVIRSRPADGEXWMPSCPQPWFVVVKEHQNLGNGSPPEAL
KKGLAADVGHMVPSSWRTEPQMYMGTEHGGCWMIASSSDRGSGDQRVKCSFHLISQGARP
IAEGLGESCPLPSAHPLWQQRSPHQMELTLKT
NT seq 3699 nt   +upstreamnt  +downstreamnt
atgctgcatttgcttgtcattgtgttgctggtagttttcaaatttagtttcgttagcctc
tcagccttgcagcactggaactgtcctgaaggctctccctctggaaatgggaattctact
tgtcttgtgccctttttaattttctcccatggaaatagtatctgtaggattgatttggaa
ggaacaaattatgaacaactggtggcagatgctggcatatcagtgatcatggattttcat
tacaatgaagaaagaatctattgggttgatctacaaagataactcttgcaaagagttcat
ttgaatgggagaaggcaagagaaagcatacgatatagataaaaatgtttcaggaatggca
ataaattggatcaatgaagaacttatttggtctaatcaacaggaaggaatcattacagta
actgatatgaaaggaaacaattcctgggttctcttaagtgctttaaaatatcctgcaaat
atagcagttgatcagtttatgttttggtcttcagaggtggctngcagccttcacagagca
gatcttggtggtatggaagtgaagcttctgttagagacatcagagacaataacagctgta
tcattggatatgcttgataaacggctcttttggattcagtaccatagaggaggaggtgat
cctcgtatttgttcctgtgattatgatggaggttctgtcctccgtcatatttagcaaata
tttagcaaatattccctgcggcacaatctgcttgcagcgtccttctttggagattgtatc
ttctattcaacatggaaaaagaagacaatttggatagctaacaagcacacagggaaggat
atggttaaaatcaccctcaactcgttatttgtgcccnccagtggaattaaagtggtccgt
ccactcgtacagcccaaggcagagggtgatgcttgggcatctgatcagaaactctgcaaa
ctgaagaaaggtaactgcagcggcagcatgtgtgagcaatagcctaagtcccaagtgtgc
acgtgtgcagagggatacactttaagccaagatggaaagaactgtgaaggtaatctgatg
agtgtaggtaagtatgcttttcggaatcatggctacacagatgactgtgaaaatatccct
ggatcctattactgcacatgccctgagggatatgttctgcttcctgatgggaaatggtgt
cactagttaatttcctgcccaagcaatatgtctgaatgcagtcaggactgtgttctgaca
tcagacggtcccatatgttcctgtcctgaaggctcagtgcttgacacagatggaaaaaat
gcagagttgctttttgtaggctgttcatcacctgataatgggggatgtagccagctctgc
acccctctcagcccagtatcctggaaatgtggctgccttcctgggtatgacctacaactg
gacaaaaagagctgtagaccttcaggaccaccaccgtttttgctgtttgccaattctcaa
gatattcgatacatgcattttgatggaacagattatggaaccctggtccaccaacaaata
ggaatggtttttaccctcgatcatgaccctgtggaaaataagactgtatgcctgtgttct
ttttcgttgatatactttgcccatacagtcctgaagtggatagaaagagctaatatggat
gcttcccagcgangaaggcttatcgaggaagaagtaggtttaccagaaggtcttgctgtt
gactggattggccataaactctactggacagacagagggaaatctctcattgaagggagt
gatttaaatggaaagtattgtgaaataatcattaaggagggcatctttcagccacgagga
natgctgttcatccaatggccaagagattattctggactgatatgggaattaatccatga
attgaaagttcttctcttcaaggcagtggccgactggttatagctagctcggatctggtc
tggcccagtggaatagcagttgattacttacctgacaagttgtattggtgcgatgccaag
cagtctgtgattgaaatgtccaatctggatggctctaaatgctgaagactttcccagaag
gatgtaggtcactcatttgccgtggctgtgtttgaggatcacgtgtggttctctgattgg
actatgccatcgataataaggatgaacaagaggactggcaaaaatagcatacgtctccca
ggcagcatgctgaagccctcatctctggttgtagttcatccattggcaaaaccaggagca
gatccatgcttacatcaaaatgganggtgtgaacatatttgcaaagagaggtttgaaact
gctcagtgtttgtgtcatgaaggttttgtgaaagctccagatggaaaaatgtgtctggct
cttgacggccatcggatattggcagatcatatgacaaacggtagtggagccaatctgaat
agtgaagtcctgccgctggacgtcttagctggcagcagagagcttgactataacatggca
gagtctcaacacctgccagtggctgagatgatggtgtcaggtttgaatcaggatactgat
gccatgggatgcggtacacgggctgagtgcctttcagagggagcggatgtcacatgtcag
tgtttgaaaggatttgctggagatggaaaacaatgttctgataagaatggacgtgagatg
ggtctctcagtttgccctcccacctcccccaagtgtgtcaatacagaaggcggctatgtc
tgccggcactcagagggctactagggagatggaatccactgtctggatattgatgagcac
cgacggggcgtgcacagctgtggggaaaatgccacctgaacaaatatggaggaaaaccac
acttgcacgcgtgctggcggcctgtctgagcctggacagatttgccctgactctactctg
ctgtctcaccttgggaagaatggacacaattttttgaaaaattgtttccctgaatgttcc
ctgaattttgaagggtactgcctcaatggtggtgtctgtatatattttggcattgacaac
ctgttctcctgccactgtcccgttggctatgccgggaagcgatgtgagtacgcagacttc
gatgggtgggatccgcactgcgctggccgtgggcatcagtggaacgtcagcccggtggct
gtccgcgtgctggtgctggctttcctgctgctccctgggctgtgcagagctcactactac
tacaggactcagaagtggctactgaaaaatccaaagaatccttgtgaagaactgagcgga
gatgtgatccgtagcaggcctgcagatggcgagngttggatgccttcttgcccccaacct
tggttcgtggttgtaaaggaacatcaaaacctcgggaatgggagtccacccgaagccctc
aagaagggcctggcagcagatgttggccatatggttccatcatcatggagaacggagccc
cagatgtatatgggcacagaacacggaggctgttggatgattgcatcatccagcgataga
ggctctggtgaccagcgggtgaagtgtagctttcatctcatctcccaaggggcacggccc
attgctgaggggcttggggaatcctgtcctctcccatcagctcaccctttgtggcaacaa
agatctccacaccaaatggagctgactctgaaaacttga

DBGET integrated database retrieval system