KEGG   Bubalus bubalis (water buffalo): 102416528Help
Entry
102416528         CDS       T05912                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00590  Arachidonic acid metabolism
bbub01100  Metabolic pathways
bbub04064  NF-kappa B signaling pathway
bbub04370  VEGF signaling pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04657  IL-17 signaling pathway
bbub04668  TNF signaling pathway
bbub04723  Retrograde endocannabinoid signaling
bbub04726  Serotonergic synapse
bbub04913  Ovarian steroidogenesis
bbub04921  Oxytocin signaling pathway
bbub04923  Regulation of lipolysis in adipocytes
bbub05140  Leishmaniasis
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05206  MicroRNAs in cancer
bbub05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102416528 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102416528 (PTGS2)
   04064 NF-kappa B signaling pathway
    102416528 (PTGS2)
   04668 TNF signaling pathway
    102416528 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102416528 (PTGS2)
   04657 IL-17 signaling pathway
    102416528 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    102416528 (PTGS2)
   04913 Ovarian steroidogenesis
    102416528 (PTGS2)
   04921 Oxytocin signaling pathway
    102416528 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    102416528 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    102416528 (PTGS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102416528 (PTGS2)
   05206 MicroRNAs in cancer
    102416528 (PTGS2)
   05204 Chemical carcinogenesis
    102416528 (PTGS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102416528 (PTGS2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102416528 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102416528 (PTGS2)
   05165 Human papillomavirus infection
    102416528 (PTGS2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102416528 (PTGS2)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102416528 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 102416528
NCBI-ProteinID: XP_025141253
LinkDB All DBs
Position
5
AA seq 604 aa AA seqDB search
MLARALLLCAAVALCGAANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPDTVHYILTHFKGVWNIVNKISFLRNMIMRYVLTSRSHLIESPPTYNVHY
SYKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGRKELPDSKEVVKKVLLRRKFIPDPQGT
NLMFAFFAQHFTHQFFKTDFERGPAFTKGKNHGVDLSHIYGESLERQHKLRLFKDGKMKY
QMINGEMYPPTVKDTQVEMIYPPHVPEHLKFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDVFQIDGQEYNYQQFIYNNSVLLKHGVTQFVESFTRQRAGRV
AGGRNLPVAVEKVSKASIDQSREMKYQSFNEYRKRFLLKPYESFEELTGEKEMAAELEAL
YGDIDAMEFYPALLVEKPRPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIINTASIRSLICSNVKGCPFTSFSVQDTHLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgggccctgctgctctgcgctgccgtggcgctctgcggtgcagcaaatcct
tgctgttcccatccatgccagaatcgaggtgtatgtatgagtgtaggatttgaccagtat
aaatgtgactgtacccgaacaggattctacggtgaaaactgtaccacacccgaatttctg
acgagaataaaattactcctgaaacccactcccgacacagtgcactacatacttacccac
ttcaagggagtctggaacattgtcaataagatctccttcctgcgaaatatgattatgaga
tatgtgttgacatcaagatcacatttgattgagagtccgccaacttataatgtgcactac
agctataaaagctgggaagccttttctaacctgtcttattataccagagctcttcctccg
gtgcctgatgactgcccaacacccatgggtgtgaaagggaggaaagagcttcctgattca
aaagaagttgtaaaaaaagtacttctaagaagaaagttcattcctgatccccagggcaca
aatctgatgtttgcattctttgcccagcacttcacccatcaatttttcaagacagatttt
gaacgaggaccagctttcactaagggaaagaaccatggggtggacttaagtcacatttat
ggtgaatctttagagagacagcataagctgcgccttttcaaggatggaaaaatgaaatat
cagatgattaatggagagatgtatcctcccacagtcaaagatactcaggtcgaaatgatc
tacccgcctcatgttcctgaacacttgaagtttgctgtgggccaggaggtctttggtctg
gtgcctggtctgatgatgtacgccaccatttggctgcgggaacacaacagagtgtgtgat
gtgcttaaacaagagcatccagaatggggcgatgagcagttgttccagacaagcaggcta
atcctgataggagaaactattaagattgtgattgaagactacgtgcagcacttgagtggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacagttccagtaccag
aaccgtattgctgctgagtttaacacgctctaccactggcatccccttctgcctgatgtc
tttcagattgatggccaggagtacaactatcagcagtttatctataacaactctgtctta
ctgaaacatggtgtcactcagtttgttgaatcattcaccaggcaaagggctggcagggtc
gctggcggtaggaatcttccagtcgcagtagagaaagtatcaaaggcttcaattgaccag
agcagagagatgaaataccagtcttttaatgagtatcgcaaacgttttctgctgaagccc
tatgaatcatttgaggaacttacaggagagaaggaaatggctgcagagttagaagcgctg
tatggagacatagatgccatggagttttatcccgcccttctggtagagaagccccgtcca
gacgccatctttggggagaccatggtagaagctggagcaccattctccctgaaaggactt
atgggtaatcctatatgctctcctgagtactggaagcctagcacttttggtggagaagta
ggttttaaaatcatcaacactgcctcaattcggtctctcatctgcagtaacgtgaaaggc
tgtccctttacctcattcagtgttcaagatacacacctcaccaaaacagtcaccattaat
gcaagctcttcgcactctggactagatgatatcaaccccacagtcctactaaaggaacgt
tcaaccgaactgtag

DBGET integrated database retrieval system