KEGG   Bubalus bubalis (water buffalo): 102416641Help
Entry
102416641         CDS       T05912                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00020  Citrate cycle (TCA cycle)
bbub00190  Oxidative phosphorylation
bbub01100  Metabolic pathways
bbub01200  Carbon metabolism
bbub04714  Thermogenesis
bbub04932  Non-alcoholic fatty liver disease (NAFLD)
bbub05010  Alzheimer disease
bbub05012  Parkinson disease
bbub05016  Huntington disease
Module
bbub_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbub_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bbub_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102416641 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102416641 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102416641 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102416641 (SDHA)
   05012 Parkinson disease
    102416641 (SDHA)
   05016 Huntington disease
    102416641 (SDHA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102416641 (SDHA)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102416641 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 102416641
NCBI-ProteinID: XP_006053542
LinkDB All DBs
Position
19
AA seq 665 aa AA seqDB search
MSGVSAVSRLLRARRLALTCTKWPAAWQTGARSFHFTVDGNKRSSAKVSDAISAQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMESGECRGVIALCI
EDGSIHRIRARNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLAVRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLRHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGD
KVPSIKPNAGEESVMNLDKLRFANGSIRTSELRLNMQKSMQSHAAVFRVGSVLQEGCEKI
SSLYGDLRHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDFKE
RVDEYDYSKPIQGQQKKPFEQHWRKHTLSYVDIKTGKVTLEYRPVIDRTLNETDCATVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtttccgctgtgtcgcgcttgttgcgcgcccggcgcctggcgctgacctgc
acgaagtggccggcagcatggcagacaggagcccgcagttttcacttcaccgttgatggc
aataagaggtcgtccgctaaagtttcagatgcgatttctgcgcagtacccagttgtggac
catgagtttgatgccgtggtggttggtgcagggggggcaggcctgcgggccgcgttcggc
ctctccgaagcaggtttcaacacggcctgcgtcacgaagctcttccccaccagatcccac
actgtcgcggcccagggagggatcaatgccgccctggggaacatggaggaggacaactgg
cggtggcacttctacgacaccgtgaaaggctcggactggctgggggaccaggacgccatc
cactacatgacggagcaggcccccgcctccgtggtggagctggagaattacggcatgccc
tttagcagaactgaagatggcaagatctaccagcgtgcctttggcggacagagcctcaag
ttcgggaagggcgggcaggcccaccgctgctgctgcgtggccgaccgcacgggccactcg
ctgctgcacacgttgtatggaaggtctctgcgctatgacaccagctactttgtggagtac
tttgccctggacctcctgatggagagcggggagtgccgcggtgtgatcgctctgtgcata
gaagatgggtccatccaccgcatcagggctaggaacactgtcatcgccaccggaggctac
gggcgcacctacttcagctgcacgtccgcccacaccagcaccggggacggcactgccatg
gtgaccagggctggcctgccctgccaggacctggagttcgtgcagttccaccccacaggc
atatatggcgctggctgtctcatcacggagggctgtcgtggagaggggggcatactcatc
aacagccagggtgagaggttcatggagcgctacgcccccgttgctaaggacctggcatcc
agggatgtcgtgtcccggtccatgaccctggaaatccgcgagggaagaggctgtgggccc
gagaaggaccacgtgtacctgcagctgcaccacctgcctccggagcagctggctgtgcgc
ctgcctggcatctcagagacggccatgatcttcgcgggcgtggacgtcaccaaggagccc
atccccgtgcttcccaccgtgcactacaacatgggtggcatccccaccaactacaagggg
caggttctgaggcacgtgaatggccaggaccaggttgtgcccggcctgtatgcatgcgga
gaggctgcctgcgcctcggtgcatggcgccaaccgtctgggtgcaaactcgctcctggac
ctggtggtcttcggccgggcgtgtgccctgagcatcgcggagtcctgcagacccggagat
aaagttccctcgattaaaccaaatgctggggaagaatctgtcatgaatcttgacaaattg
agatttgccaatggaagcataagaacatcggaactgcgactcaacatgcagaagtcgatg
cagagccacgccgccgtgttccgtgtggggagtgtgctgcaggaaggctgtgagaagatc
agcagcctctacggagacctgcggcatctgaagacgttcgacaggggaatggtctggaac
actgacctggtggagaccctggagctgcagaatctgatgctttgtgctctgcagaccatc
tacggagcggaggcccggaaggagtcgcgcggcgcccacgccagggaggacttcaaggag
agggttgacgagtacgattactccaagcccatccaggggcagcagaagaagccgtttgag
cagcactggaggaagcacacgctctcctacgttgacatcaagactgggaaggtcaccctg
gagtacagacctgtaatcgacagaactttgaacgagactgactgtgccactgttccccca
gccatccgctcctactga

DBGET integrated database retrieval system