KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0117Help
Entry
HMPREF9228_0117   CDS       T01844                                 

Definition
(GenBank) alpha amylase, catalytic domain protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv00500  Starch and sucrose metabolism
bbv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF9228_0117
Enzymes [BR:bbv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     HMPREF9228_0117
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     HMPREF9228_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: AEF26705
LinkDB All DBs
Position
complement(154255..156141)
Genome map
AA seq 628 aa AA seqDB search
MSGRVRHAEASPRPSWLSSARFYEVYPQSFADSNGDGIGDLRGLTERLGYIHDLGCNALW
INPCFDSPFKDAGYDVRDYTKVAPRYGTNDDLTALFEHAHTLGMHVLLDLVPGHTSEEHP
WFQASSRPDPTERVTPVDADRTIPVESVTPVGQTTPRIASLFDPRRRGSDCETIRRVVQE
SDTQESVSDRYIWTDSWISRGDGLPFIGGETERDGTYIINFFKCQPALNYGFAHPKHPWQ
KPALGPEALATCEAMLDVMRFWLSRGADGFRVDMADSLVKHDDDGKPFTIRTWQYIFSRI
RPEFPEAAFVAEWGRPYESMQAGFDMDFYLDWRWDGHPNGYNMLLRNTDTPLDHESDASY
FNADSGTSIAPFLEQYLPQLHDCERASGTFNLITCNHDTLRVAQRLTERELKVAYGMLLT
MPGCPFLYYGDEIGMRYRPLPTKEGGYVRTGSRTPMQWDADKPNLGFSCAPSESLYLPVD
SAADAPTVASEAAREDSLFNWVREVLALRTEQPALASDARFDVVAAPVDGRAFAYIRTPA
DGHASTHPRTTADSSSAPAPAATRDDVSDRNGATARPLLIAMNPGRGIETVELPSELRPD
ASMLLALGSPTVSGRTLTLPAQSFAILG
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggccgcgtacgacacgccgaagcatccccccgtccatcctggctgagttccgcc
cgtttttacgaggtgtacccccaaagcttcgccgactcgaacggcgacggcatcggtgat
cttcgcggactgaccgaacgacttggctatatccatgacctgggctgcaacgcactatgg
atcaatccctgcttcgattcaccgttcaaagatgccggatatgatgtgcgcgactacacg
aaggtcgcaccgcgctacggcaccaacgatgacctgaccgccctgttcgagcacgcccac
acgctcggcatgcacgtgctgctcgacttggtccccggccacaccagcgaggagcaccct
tggttccaggccagctcacgtcctgaccctactgagcgcgttacccccgttgacgccgat
cgaactatccccgtcgagagtgttacccccgtcggacaaaccaccccccgaatcgcttcg
ctcttcgacccccgccggcgggggtcggattgtgaaacaatccggagggtggtccaggaa
tccgacacccaagaatccgtctccgaccgctacatctggaccgactcgtggatctcccgc
ggcgacggcctgcccttcattggcggcgaaaccgagcgcgacggcacctacatcatcaac
ttcttcaaatgccagcccgccctcaactacggcttcgcccaccccaaacacccatggcag
aagcccgcactcggccccgaagcactggccacctgcgaggcgatgctcgacgtcatgcgc
ttctggctctcccgcggggcagacggcttccgcgtggacatggccgacagcctcgtcaaa
cacgacgacgacggcaagcctttcaccatccgcacctggcaatacatcttctcgagaatc
cgccccgaattccccgaggcagcattcgttgccgaatgggggcgcccctatgagtcgatg
caggccggcttcgacatggatttctacctcgactggcgctgggacggccatccgaacggg
tacaacatgctgctgcgtaatacggatacgccgctggaccacgagagtgacgccagttac
ttcaacgccgattccggcacttctatcgcaccgttcctcgaacaatatctgccgcagctg
cacgactgcgaacgagccagcggcaccttcaacctcatcacgtgcaatcacgacacattg
cgcgtggcacagaggcttaccgagcgcgagctcaaggtggcgtacggcatgctgctgacc
atgcccggctgcccgttcctttattacggcgacgaaatcggcatgcgataccggccgctg
cccaccaaggagggcggctatgtgcgcaccggcagtcgcacgccgatgcagtgggatgcc
gataagccgaatcttggcttctcctgcgcaccatccgagtcgttatatctgccggtcgat
tcggccgccgatgcgccgactgttgccagcgaagccgcacgcgaggattcactgttcaac
tgggttcgcgaggtgctggcattgcgcaccgagcagcccgcattggcttccgatgcccga
ttcgacgtggtggcagcgccagtggatggccgcgcgtttgcctacatacgcactcctgcg
gatggtcacgcgtccacccacccacgcacgaccgcggattccagctcggcccctgccccc
gccgccactcgcgatgatgtctcagaccgaaatggcgctacggcccggccgttgctcata
gccatgaaccccggtcgagggattgaaaccgtggaactgccgagcgaactccgtcccgat
gcatcaatgctgctagccctcggctcccccaccgtatccggtcgcaccttgacactcccc
gcccagtcattcgccatcctcggttag

DBGET integrated database retrieval system