KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0285Help
Entry
HMPREF9228_0285   CDS       T01844                                 

Definition
(GenBank) MIP family channel protein
  KO
K02440  glycerol uptake facilitator protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbv02000]
    HMPREF9228_0285
Transporters [BR:bbv02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    HMPREF9228_0285
Ion channels [BR:bbv04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   HMPREF9228_0285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP YqhR PTS_EIIC Phage_holin_5_2
Motif
Other DBs
NCBI-ProteinID: AEF27474
LinkDB All DBs
Position
350619..351353
Genome map
AA seq 244 aa AA seqDB search
MDYPLFTKLAAEFFGTAILMIFGNGSVANVELKNTKGHHAGWLNIAMGYGFGVMFPVLMF
GGVSGAHINPAMTIAQAVNGLFPWSDVLPYIVAQLLGALLGQFIVYLTYYPHYKETEDAD
AILGTFCTTDADNQKVNYFLNEMFGTLVLVFGALCCLSLAWGKQDYAAASIVVGFIVWGL
VTSMGGPTGPGLNPARDLMPRLLHAILPIPHKGSSRWGEAWIPVVAPIVGAIIGAWLYVF
FFAS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtggattatcctctctttaccaagctggccgccgagttcttcggcaccgccattctgatg
atcttcggcaacggttccgtggccaacgtcgagctcaagaacaccaagggccaccacgcc
ggctggctgaacatcgccatgggctatggcttcggcgtcatgttcccggtgctcatgttc
ggtggcgtatccggcgctcatatcaacccggccatgaccatcgcccaggccgtcaacggc
ctgttcccgtggagcgacgtgctgccgtacatcgtcgctcagctgctcggcgccctgctc
ggccagttcatcgtctacctgacctactacccgcactacaaggagaccgaggacgccgac
gccatcctcggcaccttctgcaccaccgacgcggacaaccagaaggtcaactacttcctc
aacgagatgttcggcaccctggtgctcgtcttcggcgccctgtgctgcctgtccctggct
tggggcaagcaggattacgccgccgcctccatcgtcgtcggcttcattgtgtggggcctc
gtgacctccatgggtggcccgaccggccctggcctgaacccggcccgcgacctcatgccg
cgtctgctgcacgccatcctgccaatcccgcacaagggctcctcccgctggggcgaggct
tggatcccggttgtggccccgattgtcggtgccattatcggtgcttggctgtacgtgttc
ttcttcgccagctga

DBGET integrated database retrieval system