KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0863Help
Entry
HMPREF9228_0863   CDS       T01844                                 

Definition
(GenBank) aminotransferase, class I/II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv00220  Arginine biosynthesis
bbv00250  Alanine, aspartate and glutamate metabolism
bbv00290  Valine, leucine and isoleucine biosynthesis
bbv01100  Metabolic pathways
bbv01110  Biosynthesis of secondary metabolites
bbv01130  Biosynthesis of antibiotics
bbv01210  2-Oxocarboxylic acid metabolism
bbv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF9228_0863
   00290 Valine, leucine and isoleucine biosynthesis
    HMPREF9228_0863
   00220 Arginine biosynthesis
    HMPREF9228_0863
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bbv01007]
    HMPREF9228_0863
Enzymes [BR:bbv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     HMPREF9228_0863
    2.6.1.66  valine---pyruvate transaminase
     HMPREF9228_0863
Amino acid related enzymes [BR:bbv01007]
 Aminotransferase (transaminase)
  Class I
   HMPREF9228_0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 HTH_3 HTH_19 HTH_31 Beta_elim_lyase HTH_26
Motif
Other DBs
NCBI-ProteinID: AEF26318
LinkDB All DBs
Position
complement(999743..1001278)
Genome map
AA seq 511 aa AA seqDB search
MSVSAFAERLRNAMNSRELKQVDLVHAAERRGVKMGKSHISQYVAGKTMPREDVLLFLAD
ELDVDANWLRGRSSETKLNSDAQPASHIDTPSGAPTSAETEIPAARRRTFGKSHKLDDVL
YDVRGPVVDEAARMEQAGTHVLKLNIGNPAPFGFRTPDEVVYDMAQQLPETEGYSASKGL
FSARKAIMQYAQLKNIPNVTIEDIYTGNGVSELINLSMSALLDSGDEVLVPSPDYPLWTA
CVNLAGGTAVHYLCDEKSDWYPDIDDMRKKITDRTVAIVLINPNNPTGALYPKEVLQQIV
DLAREHQLMIFSDEIYDRLVMDGLEHISIASMAPDLFCVTFSGLSKSHMIAGYRVGWMIL
SGNKAIAKDYIEGINMLTNMRICSNVPAQSIVQTALGGHQSVHDYIVPGGRIHDQRDYIY
DALNSIPGITAVKPKAAFYIFPKIDIKKFNVHDDEQFALDLLHDKRILITRGGGFNWHEP
DHFRIVYLPRIEVLKDATNKLSDFLSYYWQS
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtatcggcgtttgcggaacgactgcgcaatgcgatgaacagtagggaattgaag
caggtagatctggtgcacgccgccgaacgccgcggtgtcaagatgggcaaaagccatatc
agccaatatgttgcgggcaagaccatgccgcgagaggatgtgctgctgtttctggctgac
gaacttgatgtcgatgcgaactggcttcgtggccgatcctcggaaacaaaattgaactcc
gacgcacaacccgcttcccatattgacacaccgagcggagctcccacgtcggcggaaacg
gaaattcctgctgctcgccgccgtacctttggcaaatcacacaagcttgatgacgtactc
tacgatgttcgcggcccagtggttgatgaggcggcccgcatggaacaggccggcacccac
gtactgaagctcaacattggcaaccctgcaccgttcggcttccgtacgccggacgaggtc
gtctacgacatggcgcaacaattgcctgaaaccgaaggctattcggcttccaagggcctg
ttctccgcgcgtaaggccatcatgcagtatgcacagctcaagaacattccgaacgtcacc
atcgaagacatatacaccggcaatggtgtcagcgagctcatcaacctgtctatgtccgcg
ctgctcgacagtggcgatgaagtgcttgtgccatctccggattacccgctgtggaccgcc
tgtgtgaatctcgccggcggcaccgccgtgcattacctgtgcgacgagaagtccgactgg
tacccggatatcgacgatatgcgtaagaagatcaccgatcgtaccgtggccatcgtgctc
atcaatccgaacaatccgaccggtgcgctgtatccaaaggaagtgctgcagcagattgtc
gacttggcgcgtgagcaccagctcatgattttctccgacgaaatctacgatcgtctggtt
atggacgggctcgagcatatctccatcgcttccatggctccggatctgttctgcgtgacc
ttctccggcctgtccaagtcgcatatgatcgccggctaccgcgtgggctggatgattttg
tcgggcaacaaggccatcgccaaggattacatcgagggcatcaatatgctcaccaacatg
cgcatctgttcgaacgtgcccgcgcagtccattgtgcagaccgcgctgggcggccatcag
agcgtgcacgactatatcgtgcccggtggccgtatccatgaccaacgtgattacatctat
gacgcgttgaactccattccgggcatcaccgcggtcaagccgaaggccgcgttctatatc
ttcccgaagattgatatcaagaagttcaacgtacatgacgacgagcagttcgccctcgat
ctgctgcatgacaagcgcattctcatcacgcgcggcggcggcttcaactggcacgagccg
gatcacttccgtatcgtctacctgccacgcatcgaagtgctcaaggatgccaccaacaag
ctctccgacttcctcagctactactggcagagctga

DBGET integrated database retrieval system