KEGG   Bdellovibrio bacteriovorus W: BDW_02010Help
Entry
BDW_02010         CDS       T03036                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bbw  Bdellovibrio bacteriovorus W
Pathway
bbw00473  D-Alanine metabolism
bbw00550  Peptidoglycan biosynthesis
bbw01100  Metabolic pathways
bbw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bbw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BDW_02010
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BDW_02010
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BDW_02010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bbw01011]
    BDW_02010
Enzymes [BR:bbw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BDW_02010
Peptidoglycan biosynthesis and degradation proteins [BR:bbw01011]
 Precursor biosynthesis
  Amino acid ligase
   BDW_02010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST GARS_A RimK Ins134_P3_kin
Motif
Other DBs
NCBI-ProteinID: AHI04912
UniProt: W5WWI5
LinkDB All DBs
Position
complement(416806..417897)
Genome map
AA seq 363 aa AA seqDB search
MKKTVAVIFGGRSAEHEVSLRSARNIVEAMDKTAFAPLLIGISKCGDWFRFDDNSVFEKF
TKIENSTAQGVGTPVCLLSKDGKPQLFSFKDQSFTSVDIAFPILHGTMGEDGTIQGLFKM
VQLPFVGCGVWSSASGMDKETMKRLFTEAEIPNAKYVLLTPQKTPSYDEVVAQLGSPFFI
KPANAGSSVGVHKIKSKEDFPTKLADAFQFDHKVLAEEFIQGREIECSVMGLNQSPKASL
PGEIIPQHEFYSYEAKYLDDNGALLEIPAKLDAGSVEKLQTLAKKTYQVMGCDGLTRVDF
FLRKDGSFYVNEINTMPGFTKISMYPKMWEATGIKYSALISELISLGFEKFKEEQSLKTS
YLE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacagtagctgtcatttttggtggaagatctgcagaacatgaagtttcattg
cgctcagcgcgcaatatcgtcgaagcaatggataagacggcattcgctccattgttaatc
ggtattagcaagtgtggcgattggttccgctttgacgacaatagtgtttttgaaaagttc
actaaaattgaaaactcgacagcgcaaggcgtgggtactccagtgtgccttctttctaaa
gatggtaaacctcagcttttctcttttaaggatcaaagctttacctctgtggatattgca
tttcctatattgcacggaactatgggagaagatggtacgattcaaggtctcttcaaaatg
gttcaattaccattcgtaggctgcggcgtttggtcttcagcttctggtatggataaagag
acgatgaagcgcctttttactgaagctgaaatacctaatgcgaagtacgttcttttaaca
ccacaaaagactccttcttatgatgaggtcgtagctcagctgggaagtccttttttcatt
aagcctgccaatgcgggatcgtctgtgggtgtgcataagattaagtccaaagaagatttt
ccgactaaacttgcagacgcttttcaatttgatcacaaagttttagcagaagagtttatc
caaggacgtgagattgagtgttcggtgatgggtcttaaccaatctccgaaagcctctctc
cctggggaaatcattcctcagcacgagttctattcttacgaagcaaagtatttagacgat
aacggagctcttttagaaattccggcgaaactagatgctggcagcgtggagaaacttcaa
acgcttgctaaaaaaacctatcaggtgatgggttgcgatggcctcactcgcgtcgatttc
ttcttaagaaaagacggtagtttctacgtcaacgaaatcaacacaatgccgggttttaca
aaaatttctatgtacccaaaaatgtgggaagccactggaattaaatactctgccttgatt
tcagagttgatctctttaggctttgaaaagtttaaagaagagcagtctcttaaaacttcg
tatttagagtaa

DBGET integrated database retrieval system