KEGG   Bordetella bronchiseptica S798: BBS798_1781Help
Entry
BBS798_1781       CDS       T03637                                 

Definition
(GenBank) aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
bbx  Bordetella bronchiseptica S798
Pathway
bbx00250  Alanine, aspartate and glutamate metabolism
bbx00280  Valine, leucine and isoleucine degradation
bbx00410  beta-Alanine metabolism
bbx00640  Propanoate metabolism
bbx00650  Butanoate metabolism
bbx01100  Metabolic pathways
bbx01120  Microbial metabolism in diverse environments
Module
bbx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bbx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BBS798_1781
   00650 Butanoate metabolism
    BBS798_1781
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBS798_1781
   00280 Valine, leucine and isoleucine degradation
    BBS798_1781
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BBS798_1781
Enzymes [BR:bbx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BBS798_1781
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BBS798_1781
Amino acid related enzymes [BR:bbx01007]
 Aminotransferase (transaminase)
  Class III
   BBS798_1781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAO68507
LinkDB All DBs
Position
complement(1931739..1933013)
Genome map
AA seq 424 aa AA seqDB search
MDNAELTRRKEAATPRGVGVMCNFYADRAENAELWDTEGRRYIDFAGGIAVLNTGHRHPQ
LMQALQAQMSRFTHTAYQIVPYASYIQLAERINQLAPGDFAKKTALFTTGAEAVENAVKI
ARAATGRPAVVAFGAAFHGRTLLGMALTGKVVPYKVGFGPFPADIYHVPYPNALHGVSTD
DALAALGTLFKTDVDPRRVAAIIIEPVQGEGGFNICPPAFMQALRALCDDHGILLIADEV
QTGFGRTGKLFAMEHYGVAADLTAMAKSLAGGMPLSAVCGRAEVMDAPPPGGLGGTYAGN
PLAVAAALEVIRIIEAEDLLARGTRLGHQLRDHLEAQRHDVPEIAEVRALGAMVAVEFRQ
PGSDAPSPEFARQVQARALEQGLLLLTCGSDGNVIRFLFPLTIPEAVMREALDILARTLR
GQNA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgcagaactgacccgccgcaaggaggccgccacgccgcgcggcgtgggcgtg
atgtgcaacttctacgcggaccgcgccgagaacgccgaactgtgggataccgaaggccgc
cgctacatcgacttcgccggcggcatcgccgtgctcaacaccggccatcgccatccgcag
ctgatgcaggcgctgcaggcgcagatgagccgcttcacccacacggcctaccagatcgtc
ccgtacgccagctatatccagctggccgaacggatcaaccagctggcgccgggcgatttc
gccaagaagaccgccctcttcaccacgggagccgaggcggtcgagaacgccgtcaagatc
gcccgcgcggccaccggccggcccgccgtcgtcgccttcggcgcggcgttccacggccgc
acgctgctgggcatggccctgaccggcaaggtcgtgccgtacaaagtgggcttcggtccg
tttccggccgacatctaccatgtgccgtatccgaacgcgctgcacggggtatccaccgat
gacgcgctggcggccctggggaccctgttcaagaccgacgtggacccgcgccgcgtggcg
gccatcatcatcgaaccggtacagggcgagggcggtttcaatatctgcccgccggccttc
atgcaggcgctgcgcgccctgtgcgacgaccacggcatcctgctgatcgccgacgaagtc
cagaccggcttcggccgcaccggcaagctgttcgcgatggaacactacggcgtggcggcc
gacctgaccgccatggccaagagcctggccggcggcatgccgctgtcggcggtgtgcggc
cgcgccgaggtcatggacgcgccgccgccgggcggcctgggcggcacctatgccggcaat
ccgctggcggtggccgccgcgctggaggtgatccgcatcatcgaggccgaggacctgctg
gcgcgcggcacgcgcctgggccaccagttgcgcgaccacctggaggcgcagcgccacgac
gtccccgagatcgccgaggtgcgggcgctgggcgccatggtggcggtggaattccgccag
cccggcagcgatgcgcccagccccgaattcgcgcgccaggtccaggcccgcgcgctcgaa
caggggttgctgctcctgacctgcggcagcgacggcaacgtcatccgctttcttttcccg
ctgacgatcccggaggcggtcatgcgcgaagcgctggacatcctggcccggacgttgcgc
ggccagaacgcttga

DBGET integrated database retrieval system